DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and atoh7

DIOPT Version :10

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_012822645.1 Gene:atoh7 / 100493495 XenbaseID:XB-GENE-989022 Length:115 Species:Xenopus tropicalis


Alignment Length:60 Identity:27/60 - (45%)
Similarity:38/60 - (63%) Gaps:2/60 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 RRTACD-RERTRMRDMNRAFDLLRSKLPISKPNGKKYSKIESLRIAINYINHLQAMLRES 239
            ||.|.: |||.||:.:|.|||.||..:| .....||.||.|:|::|::||..|..:|.|:
 Frog    11 RRMAANARERRRMQGLNTAFDSLRKVVP-QWGEDKKLSKYETLQMALSYIMALNRILSEA 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 bHLH_TS 181..236 CDD:381396 25/55 (45%)
atoh7XP_012822645.1 bHLH_TS_ATOH7 4..72 CDD:381557 27/60 (45%)

Return to query results.
Submit another query.