DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and atoh1

DIOPT Version :10

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_004911142.1 Gene:atoh1 / 100488309 XenbaseID:XB-GENE-6452084 Length:260 Species:Xenopus tropicalis


Alignment Length:62 Identity:29/62 - (46%)
Similarity:39/62 - (62%) Gaps:1/62 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 MEKDYRRTACDRERTRMRDMNRAFDLLRSKLPISKPNGKKYSKIESLRIAINYINHLQAMLR 237
            ::|..|..|..|||.||..:|.|||.||:.:| |..|.||.||.|:|::|..|||.|..:|:
 Frog   104 VQKQRRLAANARERRRMHGLNHAFDQLRNVIP-SFNNDKKLSKYETLQMAQIYINALSDLLQ 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 bHLH_TS 181..236 CDD:381396 27/54 (50%)
atoh1XP_004911142.1 bHLH_TS_ATOH1 103..166 CDD:381556 29/62 (47%)

Return to query results.
Submit another query.