DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and si:ch211-196c10.13

DIOPT Version :10

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_073766453.1 Gene:si:ch211-196c10.13 / 100334878 ZFINID:ZDB-GENE-130603-71 Length:175 Species:Danio rerio


Alignment Length:66 Identity:25/66 - (37%)
Similarity:36/66 - (54%) Gaps:8/66 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 RERTRMRDMNRAFDLLRSKLP-ISKPNGKKYSKIESLRIAINYI-------NHLQAMLRESSVGQ 243
            |||.||.|:|.|.|.||:.:| .|....||.|||.:|.:|.|:|       ..::.::.:..|.|
Zfish    99 RERRRMHDLNEALDDLRAVIPYTSNRKVKKLSKIATLLLAKNHILMQARALKEMRRIVEQMDVTQ 163

  Fly   244 N 244
            |
Zfish   164 N 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 bHLH_TS 181..236 CDD:381396 22/56 (39%)
si:ch211-196c10.13XP_073766453.1 None

Return to query results.
Submit another query.