DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and mespbb

DIOPT Version :9

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001252536.1 Gene:mespbb / 100148845 ZFINID:ZDB-GENE-110609-1 Length:244 Species:Danio rerio


Alignment Length:150 Identity:44/150 - (29%)
Similarity:69/150 - (46%) Gaps:25/150 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 ELVPPPMYMSYSGGS----------IANSTEVDIAKEHNPAWREKALQMEKDYRRTACDRERTRM 192
            |.|.|..||.:|..:          |:.|:..|..:......|.:.....|. |::|.::|:.||
Zfish    29 ETVSPSSYMDFSPSAQAQSVSPKPEISGSSFQDGGRSRVGVRRTRCKNPSKQ-RQSASEKEKLRM 92

  Fly   193 RDMNRAFDLLRSKLPIS-KPNGKKYSKIESLRIAINYINHLQAMLRESSVGQNGNGCCAW----- 251
            ||:.:|...||:.||.| .|.|:..:|||:||:.|.||::|.|.|     |.:....|..     
Zfish    93 RDLTKALHHLRTYLPPSVAPVGQTLTKIETLRLTIRYISYLSAQL-----GLSEESLCKMRDLRV 152

  Fly   252 SGGSSSPYD---NGNDHWGA 268
            ||....|.:   :..:.||:
Zfish   153 SGYQEMPQNHCYSTAEFWGS 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 HLH 181..233 CDD:278439 23/52 (44%)
mespbbNP_001252536.1 HLH 80..133 CDD:278439 23/53 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170584018
Domainoid 1 1.000 54 1.000 Domainoid score I11202
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24509
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.