DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and tcf21

DIOPT Version :10

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001103518.1 Gene:tcf21 / 100126209 XenbaseID:XB-GENE-484805 Length:179 Species:Xenopus tropicalis


Alignment Length:92 Identity:31/92 - (33%)
Similarity:49/92 - (53%) Gaps:20/92 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 QMEKDYRRTACD-RERTRMRDMNRAFDLLRSKLPISKPNGKKYSKIESLRIAINYINHLQAMLRE 238
            |..|..:|.|.: |||.|||.:::||..|::.||...|: .|.||:::||:|.:||.||:.:|  
 Frog    74 QEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPD-TKLSKLDTLRLASSYIAHLRQIL-- 135

  Fly   239 SSVGQNGNGCCAWSGGSSSPYDNGNDH 265
                            ::..|:||..|
 Frog   136 ----------------ANDKYENGYIH 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 bHLH_TS 181..236 CDD:381396 24/55 (44%)
tcf21NP_001103518.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..87 4/12 (33%)
bHLH_TS_TCF21_capsulin 77..140 CDD:381547 26/81 (32%)

Return to query results.
Submit another query.