DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP6AP2 and atp6ap2

DIOPT Version :9

Sequence 1:NP_649876.1 Gene:ATP6AP2 / 41104 FlyBaseID:FBgn0037671 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001011319.1 Gene:atp6ap2 / 496778 XenbaseID:XB-GENE-964301 Length:348 Species:Xenopus tropicalis


Alignment Length:361 Identity:101/361 - (27%)
Similarity:170/361 - (47%) Gaps:55/361 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLRVFVIFSLFIAAINASGEFTVLNRPKAISF-KGNDALESHYVGDVLYASMGNAVSGDTNWNGL 64
            |||: .:.:|.:|.  .|.:|.||..|:...| :||..:....:.||:..|||.:|..|.:|:||
 Frog     1 MLRL-ALAALVLAV--TSADFNVLKSPRYPIFQEGNWPVPGDRIPDVILLSMGFSVEEDLSWSGL 62

  Fly    65 TINDPFNLAKGVILVHVQGIGHVTTAGNVKTYELTGS---GTDASLNAL-------------AAE 113
            .:.:.|...:..:||.|.|:..:..:||..:|.:..:   ..|:.:|::             .|.
 Frog    63 GVGNLFQRPRATVLVTVTGVNKLPLSGNGISYPVENAVPYSVDSVVNSIHSVFSEEMPVVLQLAP 127

  Fly   114 LE-------AANEPVCDI---------NFEQFDDGVQAW--KSCFGDFEAPAAKPTKHLNPSLHT 160
            :|       .||....|:         ..||.:..:|:.  .|.:.:.|          ...|..
 Frog   128 IEERVYMVGKANTVFEDLAVTLRQLRTRLEQDNSVIQSLPVSSLYRNDE----------TDRLFL 182

  Fly   161 ADKQFLQEVGFINSAADHLAEMAKPSNVLMLRVSVDGVAKAHGEKSVAVEEANKLLSAAISRLL- 224
            ::.|.||::..:.|...|||:...|....:....::.:.|.:||.|...::|.::||.::.:.. 
 Frog   183 SELQVLQDIVTLLSGHKHLAKDNVPDVYSLELTGLEEIKKRYGEDSAQFKDAVQILSDSLEKFAD 247

  Fly   225 -AASQKSSDSVLFVQTTEK-DVAASRAKRDTIAASTT----NPYNLAVYYGSDYPVIFNIILWFM 283
             ..|....::::.|.|.|. ::...|..|..:|:...    :|||||..|..||.||||||||.|
 Frog   248 DMYSFYGGNAIVEVVTVESFEIPLVRRSRSILASEAISNPGSPYNLAYQYNFDYSVIFNIILWIM 312

  Fly   284 VVFGLSLLAICYAIAAMDPGRDSIIYRMTSTRIKKD 319
            :...|:::||.|.:..||||.||||||||:.:|:.|
 Frog   313 IGLALAVIAISYNLWNMDPGYDSIIYRMTNQKIRMD 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATP6AP2NP_649876.1 Renin_r 231..319 CDD:369555 40/92 (43%)
atp6ap2NP_001011319.1 Renin_r 253..348 CDD:369555 40/94 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8866
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H38097
Inparanoid 1 1.050 118 1.000 Inparanoid score I4644
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1179410at2759
OrthoFinder 1 1.000 - - FOG0007261
OrthoInspector 1 1.000 - - oto103566
Panther 1 1.100 - - LDO PTHR13351
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6151
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.