DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and SLC25A27

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_004268.3 Gene:SLC25A27 / 9481 HGNCID:21065 Length:323 Species:Homo sapiens


Alignment Length:315 Identity:69/315 - (21%)
Similarity:121/315 - (38%) Gaps:91/315 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TTAQLLSHPMELVRVNMQ-------ANVIHHSRLSINHMFRLMARHGL-----PGF---YYGIVA 60
            |.|:|.:.|::|.:..:|       |.:...:|.|.  .:|.|.|..|     .||   :.|:..
Human    31 TVAELATFPLDLTKTRLQMQGEAALARLGDGARESA--PYRGMVRTALGIIEEEGFLKLWQGVTP 93

  Fly    61 ACLRCTVHT---MSTY-----TLFYNLQDNKYVLMLQPYNTSMVLG-ITGFWGGVLATPFAKLAV 116
            |..|..|::   |.||     .:|...:|..|     |...|::.| :.|..|..||.|      
Human    94 AIYRHVVYSGGRMVTYEHLREVVFGKSEDEHY-----PLWKSVIGGMMAGVIGQFLANP------ 147

  Fly   117 IRQADLTRGSYERRNYRNF------WRGLKCMYAK----GGFTYLFTGWKINSISSTAVA----- 166
               .||.:...:....|..      :||:...:||    ||...|:.|| :.:|...|:.     
Human   148 ---TDLVKVQMQMEGKRKLEGKPLRFRGVHHAFAKILAEGGIRGLWAGW-VPNIQRAALVNMGDL 208

  Fly   167 ----------VLYTPISDKVHTVISWFHRLDEPWLSDLITMALTGSIITVIMTPVDALATLTLNE 221
                      ||.||:.|.:.|     |.|         :...:|.:.:::.||.|.:.:..:|:
Human   209 TTYDTVKHYLVLNTPLEDNIMT-----HGL---------SSLCSGLVASILGTPADVIKSRIMNQ 259

  Fly   222 -SSHYGRTSYPYLYR-------KIIRKHGYKGFFFGWKPALMALIPHTVLATFVY 268
             ....||   ..||:       :.::..|:...:.|:.|:.:.:.|.:::....|
Human   260 PRDKQGR---GLLYKSSTDCLIQAVQGEGFMSLYKGFLPSWLRMTPWSMVFWLTY 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 23/92 (25%)
Mito_carr 187..277 CDD:278578 14/90 (16%)
SLC25A27NP_004268.3 Mito_carr 20..118 CDD:365909 22/88 (25%)
Solcar 1 21..115 22/85 (26%)
Mito_carr 125..219 CDD:365909 23/108 (21%)
Solcar 2 125..217 23/106 (22%)
Solcar 3 226..317 18/103 (17%)
Mito_carr 227..317 CDD:365909 17/102 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.