DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and Slc25a14

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_006257593.1 Gene:Slc25a14 / 85263 RGDID:621433 Length:344 Species:Rattus norvegicus


Alignment Length:310 Identity:68/310 - (21%)
Similarity:121/310 - (39%) Gaps:72/310 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PVYVGLLIKTTAQLLSHPMELVRVNMQA---------NVIHHSRLSINHMFRLMARHGLPGFYYG 57
            |...|.|....|:..:.|::|.:..:|.         ..|.: |...:.:||:....|:...|.|
  Rat    62 PFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDVRFKEIKY-RGMFHALFRIYREEGILALYSG 125

  Fly    58 IVAACLRCTVHTMSTYTLFYNLQDNKYVLMLQPYNTSMVLGITGFWGGVLATPFA------KLAV 116
            |..|.||...:......::.:|: ..:|..|:. .|.::..|.|...||:::..|      |:.:
  Rat   126 IAPALLRQASYGTIKIGIYQSLK-RLFVERLED-ETLLINMICGVVSGVISSTIANPTDVLKIRM 188

  Fly   117 IRQADLTRGS--------YERRNYRNFWRGLKCMYAKGGFTYLFTGWKINSISSTAVAV-LYTPI 172
            ..|..|.:||        |::...|..|||:                 :.:....|:.| :..|:
  Rat   189 QAQGSLFQGSMIGSFIDIYQQEGTRGLWRGV-----------------VPTAQRAAIVVGVELPV 236

  Fly   173 SD--KVHTVISWFHRLDEPWLSDLI---TMALTGSIITVIMTPVDALATLTLNESSHYGRTSYPY 232
            .|  |.|.::|..  |.:..|:..:   |..|.|::.:   .|||.:.|..:|:.:..|...   
  Rat   237 YDITKKHLIVSGM--LGDTILTHFVSSFTCGLAGALAS---NPVDVVRTRMMNQRAIVGHVD--- 293

  Fly   233 LYR-------KIIRKHG----YKGFFFGWKPALMALIPHTVLATFVYRFL 271
            ||:       |:.:..|    ||||:..|    :.|.|..::....|..|
  Rat   294 LYKGTLDGILKMWKHEGFFALYKGFWPNW----LRLGPWNIIFFITYEQL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 18/83 (22%)
Mito_carr 187..277 CDD:278578 23/99 (23%)
Slc25a14XP_006257593.1 PTZ00169 63..342 CDD:240302 67/309 (22%)
Mito_carr 253..342 CDD:395101 23/97 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.