DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and Slc25a27

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_006244672.1 Gene:Slc25a27 / 85262 RGDID:620787 Length:365 Species:Rattus norvegicus


Alignment Length:300 Identity:71/300 - (23%)
Similarity:112/300 - (37%) Gaps:93/300 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TTAQLLSHPMEL--VRVNMQANVIHHSRLSINHM----FRLMARHGL-----PGF---YYGIVAA 61
            |.|:|.:.|::|  .|:.||.... .::|....|    :|.|.|..|     .||   :.|:..|
  Rat    30 TVAELATFPLDLTKTRLQMQGEAA-LAKLGDGAMESAPYRGMMRTALGIVQEEGFLKLWQGVTPA 93

  Fly    62 CLRCTVHT---MSTY-----TLFYNLQDNKYVLMLQPYNTSMVLG-ITGFWGGVLATPFAKLAVI 117
            ..|..|::   |.||     .:|...:|..|     |...|::.| :.|..|..||.|       
  Rat    94 IYRHVVYSGGRMVTYEHLREVVFGKSEDEHY-----PLWKSVIGGMMAGVIGQFLANP------- 146

  Fly   118 RQADLTRGSYERRNYRNF------WRGLKCMYAK----GGFTYLFTGWKINSISSTAVA------ 166
              .||.:...:....|..      :||:...:||    ||...|:.|| |.:|...|:.      
  Rat   147 --TDLVKVQMQMEGKRRLEGKPLRFRGVHHAFAKILAEGGIRGLWAGW-IPNIQRAALVNMGDLT 208

  Fly   167 ---------VLYTPISDKVHTVISWFHRLDEPWLSDLITMALTGSIITVIMTPVDALATLTLNE- 221
                     ||.|.:.|.:.|     |.|         :...:|.:.:::.||.|.:.:..:|: 
  Rat   209 TYDTVKHYLVLNTALEDNIAT-----HGL---------SSLCSGLVASILGTPADVIKSRIMNQP 259

  Fly   222 SSHYGRTSYPYLYR-------KIIRKHG----YKGFFFGW 250
            ....||   ..||:       :.::..|    ||||...|
  Rat   260 RDKQGR---GLLYKSSTDCVIQAVQGEGFLSLYKGFLPSW 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 24/91 (26%)
Mito_carr 187..277 CDD:278578 14/75 (19%)
Slc25a27XP_006244672.1 Mito_carr 20..119 CDD:278578 24/89 (27%)
Mito_carr 122..218 CDD:278578 24/110 (22%)
Mito_carr 224..311 CDD:278578 18/89 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.