DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and SLC25A11

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_024306762.1 Gene:SLC25A11 / 8402 HGNCID:10981 Length:342 Species:Homo sapiens


Alignment Length:311 Identity:78/311 - (25%)
Similarity:124/311 - (39%) Gaps:73/311 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AQLLSHPMELVRVNMQAN----VIHHSRLSINHMFRLMARHGLPGFYYG---------------- 57
            |.:...|::||:..||.:    .....:.|.:.:..::...||.|.|.|                
Human    35 ATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGYWGLRMEGRLWVGSSR 99

  Fly    58 ------------IVAACLRCTVHT---MSTYTLFYNLQDNK------YVLMLQPYNTSMVLGIT- 100
                        :.|..||...:|   :..||:.:......      ::|       ..|:|:| 
Human   100 PWPDMLTPLLLRLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLL-------KAVIGMTA 157

  Fly   101 GFWGGVLATPFAKLAVIRQ-ADLTRGSYERRNYRNFWRGLKCMYAKGGFTYLFTGWKINSISSTA 164
            |..|..:.|| |::|:||. ||....:.:||.|:|.:..|..:..:.|...|:.|    .|.:.|
Human   158 GATGAFVGTP-AEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRG----CIPTMA 217

  Fly   165 VAVLYTPISDKVHTVISWFHRLDEPWLSDLITMALTGSIITVIMT-----PVDALATLTLNESSH 224
            .||:........::....| .||..:.||.|......|:|:.::|     |||...|...|....
Human   218 RAVVVNAAQLASYSQSKQF-LLDSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMI 281

  Fly   225 YGRTSY----PYLYRKIIRKHGYKGFFFGWK---PALMALIPHTVLATFVY 268
            .|:..|    ..|: |::|   |:|||..||   |....|.||||| ||::
Human   282 DGKPEYKNGLDVLF-KVVR---YEGFFSLWKGFTPYYARLGPHTVL-TFIF 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 18/102 (18%)
Mito_carr 187..277 CDD:278578 32/94 (34%)
SLC25A11XP_024306762.1 Mito_carr 24..>85 CDD:278578 12/49 (24%)
Mito_carr 144..241 CDD:278578 29/109 (27%)
Mito_carr 243..337 CDD:278578 31/90 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.