DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and ucp1

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_955817.1 Gene:ucp1 / 83908 ZFINID:ZDB-GENE-010503-1 Length:309 Species:Danio rerio


Alignment Length:297 Identity:70/297 - (23%)
Similarity:112/297 - (37%) Gaps:69/297 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PVYVGLLIKTT----AQLLSHPMELVRVNMQ----------ANVIHHSRL--SINHMFRLMARHG 50
            |:.|.:|...|    |.|::.|::..:|.:|          |..|.:..:  :|:.|.|   ..|
Zfish    12 PLTVKVLSAGTAACIADLVTFPLDTAKVRLQIQGEKAVTGAAKGIRYKGVFGTISTMMR---TEG 73

  Fly    51 LPGFYYGIVAACLRCTVHTMSTYTLFYNLQDN-KYVLMLQPYNTSMVLGI-----TGFWGGVLAT 109
            ....|.|:||...|    .|:..::...|.|| |........|.::.:.|     ||.....:|.
Zfish    74 PRSLYNGLVAGLQR----QMAFASIRIGLYDNVKSFYTRGKDNPNVAVRILAGCTTGAMAVSMAQ 134

  Fly   110 PFAKLAVIRQADLTRGSYERRNYRNFWRGLKCMYAKGGFTYLFTGWK-------INSISSTAVAV 167
            |...:.|..||.:......|| |....:..:.::...|...|   ||       .|::.:....|
Zfish   135 PTDVVKVRFQAQMNLQGVGRR-YNGTMQAYRQIFQLEGLRGL---WKGTLPNITRNALVNCTELV 195

  Fly   168 LYTPISDKVHTVISWFHRLDEPWLSD-----LITMALTGSIITVIMTPVDALATLTLNESSHYGR 227
            .|..|.:.:..     |||    |||     .::....|.|.|||.:|||.:.|..:|       
Zfish   196 SYDLIKEAILK-----HRL----LSDNLPCHFVSAFGAGFITTVIASPVDVVKTRYMN------- 244

  Fly   228 TSYPYLYRK-------IIRKHGYKGFFFGWKPALMAL 257
             |.|..|..       ::.|.|...|:.|:.|:.:.|
Zfish   245 -SPPGQYSSSTNCAWTMLTKEGPTAFYKGFVPSFLRL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 20/90 (22%)
Mito_carr 187..277 CDD:278578 22/83 (27%)
ucp1NP_955817.1 Mito_carr 10..110 CDD:395101 25/104 (24%)
Mito_carr 111..208 CDD:395101 20/105 (19%)
Mito_carr 213..299 CDD:395101 19/76 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.