DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and DIC3

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_196509.1 Gene:DIC3 / 830806 AraportID:AT5G09470 Length:337 Species:Arabidopsis thaliana


Alignment Length:322 Identity:65/322 - (20%)
Similarity:114/322 - (35%) Gaps:66/322 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PVYVGLLIKTTAQLLSHPMELVRVNMQANVIHHSRLSINHMFRLMARHGLP-------------- 52
            |...|.:....|..|:||::|::|.||....|...|..|....|...|.||              
plant     5 PFLEGGIAAIIAGALTHPLDLIKVRMQLQGEHSFSLDQNPNPNLSLDHNLPVKPYRPVFALDSLI 69

  Fly    53 -------------------------------------GFYYGIVAACLRCTVHTMSTYTLFYNLQ 80
                                                 ..:.|:.|..||..::: :|....|:..
plant    70 GSISLLPLHIHAPSSSTRSVMTPFAVGAHIVKTEGPAALFSGVSATILRQMLYS-ATRMGIYDFL 133

  Fly    81 DNKYVLMLQ---PYNTSMVLG-ITGFWGGVLATPFAKLAVIR-QADLTRGSYERRNYRNFWRGLK 140
            ..::...|.   |..|.:..| |.|..|.|:..| |.:|::| |||.:.....||||::....:.
plant   134 KRRWTDQLTGNFPLVTKITAGLIAGAVGSVVGNP-ADVAMVRMQADGSLPLNRRRNYKSVVDAID 197

  Fly   141 CMYAKGGFTYLFTG-W-KINSISSTAVAVLYTPISDKVHTVISWFHRLDEPWLSDLITMALTGSI 203
            .:..:.|.:.|:.| | .:|.......:.|.|  .|.|..::....|.....:...:..:....|
plant   198 RIARQEGVSSLWRGSWLTVNRAMIVTASQLAT--YDHVKEILVAGGRGTPGGIGTHVAASFAAGI 260

  Fly   204 ITVIMT-PVDALATLTLN-ESSHYGRTSYPYLYRKIIRKHGYKGFFFGWKPALMALIPHTVL 263
            :..:.: |:|.:.|..:| :...||......:  |::.:.|....:.|..|......|.|::
plant   261 VAAVASNPIDVVKTRMMNADKEIYGGPLDCAV--KMVAEEGPMALYKGLVPTATRQGPFTMI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 22/125 (18%)
Mito_carr 187..277 CDD:278578 13/79 (16%)
DIC3NP_196509.1 Mito_carr <19..139 CDD:395101 20/120 (17%)
Mito_carr 143..238 CDD:395101 27/97 (28%)
Mito_carr 251..336 CDD:395101 13/72 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.