DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and DIC2

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_194188.1 Gene:DIC2 / 828559 AraportID:AT4G24570 Length:313 Species:Arabidopsis thaliana


Alignment Length:307 Identity:60/307 - (19%)
Similarity:112/307 - (36%) Gaps:66/307 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GLLIKTTAQLLSHPMELVRVNMQANVIHHSRLSINHM---------------------------- 42
            |.:....|...:||::|::|.:|.:....|..::..:                            
plant     9 GGIASVIAGCSTHPLDLIKVRLQLHGEAPSTTTVTLLRPALAFPNSSPAAFLETTSSVPKVGPIS 73

  Fly    43 --FRLMARHGLPGFYYGIVAACLRCTVHTMSTYTLFYNLQDNKYVLMLQP----YNTSMVLG--- 98
              ..::...|....:.|:.|..||.|:::.:...| |.:..||:.   .|    .|.|..:|   
plant    74 LGINIVKSEGAAALFSGVSATLLRQTLYSTTRMGL-YEVLKNKWT---DPESGKLNLSRKIGAGL 134

  Fly    99 ITGFWGGVLATPFAKLAVIR-QADLTRGSYERRNYRNFWRGLKCMYAKGGFTYLFTGWKIN---- 158
            :.|..|..:..| |.:|::| |||......:||||......::.|....|.|.|:.|..:.    
plant   135 VAGGIGAAVGNP-ADVAMVRMQADGRLPLAQRRNYAGVGDAIRSMVKGEGVTSLWRGSALTINRA 198

  Fly   159 SISSTAVAVLYTPISDKVHTVISWFHRLDEPWLSD-----LITMALTGSIITVIMTPVDALATLT 218
            .|.:.|....|....:.:         |:...::|     ::.....|.:.:|...|||.:.|..
plant   199 MIVTAAQLASYDQFKEGI---------LENGVMNDGLGTHVVASFAAGFVASVASNPVDVIKTRV 254

  Fly   219 LN--ESSHYGRTSYPYLYRKIIRKHGYKGFFFGWKPALMALIPHTVL 263
            :|  ..::.|......   |.::..|....:.|:.|.:....|.||:
plant   255 MNMKVGAYDGAWDCAV---KTVKAEGAMALYKGFVPTVCRQGPFTVV 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 16/104 (15%)
Mito_carr 187..277 CDD:278578 16/84 (19%)
DIC2NP_194188.1 Mito_carr 3..118 CDD:395101 18/112 (16%)
Mito_carr 122..220 CDD:395101 25/107 (23%)
Mito_carr 225..312 CDD:395101 15/77 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.