DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and Slc25a27

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_017173167.1 Gene:Slc25a27 / 74011 MGIID:1921261 Length:344 Species:Mus musculus


Alignment Length:296 Identity:70/296 - (23%)
Similarity:110/296 - (37%) Gaps:93/296 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLSHPMEL--VRVNMQANVIHHSRLSINHM----FRLMARHGL-----PGF---YYGIVAACLRC 65
            |.:.|::|  .|:.||.... .:||....:    :|.|.|..|     .||   :.|:..|..|.
Mouse    48 LTTFPLDLTKTRLQMQGEAA-LARLGDGAVDSAPYRGMVRTALGIVQEEGFLKLWQGVTPAIYRH 111

  Fly    66 TVHT---MSTY-----TLFYNLQDNKYVLMLQPYNTSMVLG-ITGFWGGVLATPFAKLAVIRQAD 121
            .|::   |.||     .:|...:|..|     |...|::.| :.|..|..||.|         .|
Mouse   112 VVYSGGRMVTYEHLREVVFGKSEDKHY-----PLWKSVIGGMMAGVIGQFLANP---------TD 162

  Fly   122 LTRGSYERRNYRNF------WRGLKCMYAK----GGFTYLFTGWKINSISSTAVA---------- 166
            |.:...:....|..      :||:...:||    ||...|:.|| |.:|...|:.          
Mouse   163 LVKVQMQMEGKRRLEGKPLRFRGVHHAFAKILAEGGIRGLWAGW-IPNIQRAALVNMGDLTTYDT 226

  Fly   167 -----VLYTPISDKVHTVISWFHRLDEPWLSDLITMALTGSIITVIMTPVDALATLTLNE-SSHY 225
                 ||.||:.|.:.|     |.|         :...:|.:.:::.||.|.:.:..:|: ....
Mouse   227 VKHYLVLNTPLEDNIST-----HGL---------SSLCSGLVASILGTPADVIKSRIMNQPRDKQ 277

  Fly   226 GRTSYPYLYR-------KIIRKHG----YKGFFFGW 250
            ||   ..||:       :.::..|    ||||...|
Mouse   278 GR---GLLYKSSADCLIQAVQGEGFLSLYKGFLPSW 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 22/87 (25%)
Mito_carr 187..277 CDD:278578 15/76 (20%)
Slc25a27XP_017173167.1 Mito_carr 48..131 CDD:365909 21/83 (25%)
Mito_carr 138..232 CDD:365909 24/108 (22%)
Mito_carr 240..>314 CDD:365909 18/88 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.