DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and UCP2

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_024304442.1 Gene:UCP2 / 7351 HGNCID:12518 Length:310 Species:Homo sapiens


Alignment Length:284 Identity:61/284 - (21%)
Similarity:111/284 - (39%) Gaps:53/284 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SHPMELVRVN------MQANVIHHSRLSINHMFRLMARHGLPGFYYGIVAACLRCTVHTMSTYTL 75
            |:|:..:::.      ::|......|..:..:..::...|....|.|:||...|    .||    
Human    36 SYPVLALQIQGESQGPVRATASAQYRGVMGTILTMVRTEGPRSLYNGLVAGLQR----QMS---- 92

  Fly    76 FYNLQDNKYVLMLQPY---NTSMVLG---ITGFWGGVLATPFAKLAVIRQADLTRGSYER----- 129
            |.:::...|..:.|.|   :....:|   :.|...|.||     :||.:..|:.:..::.     
Human    93 FASVRIGLYDSVKQFYTKGSEHASIGSRLLAGSTTGALA-----VAVAQPTDVVKVRFQAQARAG 152

  Fly   130 --RNYRNFWRGLKCMYAKGGFTYLFTGWK----INSISSTAVAVLYTPISDKVHTVISWFHRLDE 188
              |.|::.....|.:..:.||..|:.|..    .|:|.:.|..|.|..|.|.:         |..
Human   153 GGRRYQSTVNAYKTIAREEGFRGLWKGTSPNVARNAIVNCAELVTYDLIKDAL---------LKA 208

  Fly   189 PWLSDLITMALT-----GSIITVIMTPVDALATLTLNES-SHYGRTSYPYLYRKIIRKHGYKGFF 247
            ..::|.:....|     |...|||.:|||.:.|..:|.: ..|....:..|  .:::|.|.:.|:
Human   209 NLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSALGQYSSAGHCAL--TMLQKEGPRAFY 271

  Fly   248 FGWKPALMALIPHTVLATFVYRFL 271
            .|:.|:.:.|....|:....|..|
Human   272 KGFMPSFLRLGSWNVVMFVTYEQL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 13/69 (19%)
Mito_carr 187..277 CDD:278578 22/91 (24%)
UCP2XP_024304442.1 Mito_carr <42..112 CDD:332982 14/77 (18%)
Mito_carr 113..207 CDD:278578 22/107 (21%)
Mito_carr 218..300 CDD:278578 21/80 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.