DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and UCP1

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_068605.1 Gene:UCP1 / 7350 HGNCID:12517 Length:307 Species:Homo sapiens


Alignment Length:262 Identity:50/262 - (19%)
Similarity:80/262 - (30%) Gaps:107/262 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VYVGLLIKTTAQLLSHPMELVRVNMQANVIHHSRLSINHMFRLMARHGLPGFYYGIVAACLRCTV 67
            :..||.....|..:..|.|:|:|.:||.         :|:      ||:...|.|          
Human   117 ILAGLTTGGVAVFIGQPTEVVKVRLQAQ---------SHL------HGIKPRYTG---------- 156

  Fly    68 HTMSTYTLFYNLQDNKYVLMLQPYNTSMVLGITGFWGGVLATPFAKLAVIRQA------DLTRGS 126
             |.:.|.:....:                 |:||.|.|  .||....:||...      ||.:.:
Human   157 -TYNAYRIIATTE-----------------GLTGLWKG--TTPNLMRSVIINCTELVTYDLMKEA 201

  Fly   127 YERRNYRNFWRGLKCMYAKGGFTYLFTGWKINSISSTAVAVLYTPISDKVHTVISWFHRLDEPWL 191
            :.:.|.                                       ::|            |.|  
Human   202 FVKNNI---------------------------------------LAD------------DVP-- 213

  Fly   192 SDLITMALTGSIITVIMTPVDALATLTLNESSHYGR-TSYPYLYRKIIRKHGYKGFFFGWKPALM 255
            ..|::..:.|...|.:.:|||.:.|..:|  |..|: .|.|....|:....|...||.|..|:.:
Human   214 CHLVSALIAGFCATAMSSPVDVVKTRFIN--SPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFL 276

  Fly   256 AL 257
            .|
Human   277 RL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 16/74 (22%)
Mito_carr 187..277 CDD:278578 21/72 (29%)
UCP1NP_068605.1 Mito_carr 10..104 CDD:278578
Solcar 1 11..102
Mito_carr 111..206 CDD:278578 27/133 (20%)
Solcar 2 111..201 27/128 (21%)
Solcar 3 210..295 22/85 (26%)
Mito_carr 215..300 CDD:278578 19/66 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.