DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and Slc25a11

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_071793.2 Gene:Slc25a11 / 64201 RGDID:708476 Length:314 Species:Rattus norvegicus


Alignment Length:282 Identity:76/282 - (26%)
Similarity:124/282 - (43%) Gaps:43/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AQLLSHPMELVRVNMQAN----VIHHSRLSINHMFRLMARHGLPGFYYGIVAACLRCTVHT---M 70
            |.:...|::||:..||.:    .....:.|.:.:..::...||.|.|.|:.|..||...:|   :
  Rat    35 ATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRL 99

  Fly    71 STYTLFYNLQDNK------YVLMLQPYNTSMVLGIT-GFWGGVLATPFAKLAVIRQ-ADLTRGSY 127
            ..||:.:......      ::|       ..::|:| |..|..:.|| |::|:||. ||....:.
  Rat   100 GIYTVLFERLTGADGTPPGFLL-------KALIGMTAGATGAFVGTP-AEVALIRMTADGRLPAD 156

  Fly   128 ERRNYRNFWRGLKCMYAKGGFTYLFTGWKINSISSTAVAVLYTPISDKVHTVISWFHRLDEPWLS 192
            :||.|:|.:..|..:..:.|...|:.|    .|.:.|.||:........::....| .||..:.|
  Rat   157 QRRGYKNVFNALIRIAREEGVPTLWRG----CIPTMARAVVVNAAQLASYSQSKQF-LLDSGYFS 216

  Fly   193 DLITMALTGSIITVIMT-----PVDALATLTLNESSHYGRTSYPY---LYRKIIRKHGYKGFFFG 249
            |.|......|:|:.::|     |||.:.|...|.....|:..|..   :..|::|   |:|||..
  Rat   217 DNILCHFCASMISGLVTTAASMPVDIVKTRIQNMRMIDGKPEYKNGLDVLLKVVR---YEGFFSL 278

  Fly   250 WK---PALMALIPHTVLATFVY 268
            ||   |....|.||||| ||::
  Rat   279 WKGFTPYYARLGPHTVL-TFIF 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 18/74 (24%)
Mito_carr 187..277 CDD:278578 31/93 (33%)
Slc25a11NP_071793.2 Solcar 1 23..108 18/72 (25%)
Mito_carr 24..102 CDD:395101 16/66 (24%)
Mito_carr 116..213 CDD:395101 28/109 (26%)
Solcar 2 117..208 25/102 (25%)
Mito_carr 215..313 CDD:395101 30/89 (34%)
Solcar 3 217..306 29/87 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.