DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and mfrn

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster


Alignment Length:310 Identity:65/310 - (20%)
Similarity:99/310 - (31%) Gaps:88/310 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VYVGLLIKTTAQLLSH----PMELVRVNMQANVIHHSRLSINHMFRLM-ARHGL----------- 51
            |.|.:.....|.:|.|    |::.|:..||:.......::|....|.| .|.||           
  Fly    14 VGVNMTAGAIAGVLEHVVMYPLDSVKTRMQSLSPPTKNMNIVSTLRTMITREGLLRPIRGASAVV 78

  Fly    52 --PGFYYGIVAACLRCTVHTMSTYTLFYNLQDNKYVLMLQPYNTSMVLGITGFWGGVLATPF--- 111
              .|..:.:..|....|....:.:|...||   .||:                 .|.:||..   
  Fly    79 LGAGPAHSLYFAAYEMTKELTAKFTSVRNL---NYVI-----------------SGAVATLIHDA 123

  Fly   112 --AKLAVIRQ------------ADLTRGSYERRNYRNFWRG------LKCMYAKGGF-TYLFTGW 155
              :...||:|            ....|..|:|..::.|:|.      :...|....| ||.|...
  Fly   124 ISSPTDVIKQRMQMYNSPYTSVVSCVRDIYKREGFKAFYRAYGTQLVMNLPYQTIHFTTYEFFQN 188

  Fly   156 KINSISSTAVAVLYTPISDKVHTVISWFHRLDEPWLSDLITMALTGSIITVIMTPVDALATLTLN 220
            |:|      :...|.|   .||                :...|..|:....:.||:|.:.||...
  Fly   189 KMN------LERKYNP---PVH----------------MAAGAAAGACAAAVTTPLDVIKTLLNT 228

  Fly   221 ESSHYGRTSYPYLYRKIIRKHGYKGFFFGWKPALMALIPHTVLATFVYRF 270
            :.:...|.... ..|||....|..|||.|....::..:|.|.:....|.|
  Fly   229 QETGLTRGMIE-ASRKIYHMAGPLGFFRGTTARVLYSMPATAICWSTYEF 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 19/92 (21%)
Mito_carr 187..277 CDD:278578 20/84 (24%)
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 18/83 (22%)
PTZ00168 17..280 CDD:185494 63/307 (21%)
Mito_carr 107..190 CDD:278578 20/102 (20%)
Mito_carr <215..282 CDD:278578 18/64 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441235
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.