DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and CG4743

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster


Alignment Length:285 Identity:59/285 - (20%)
Similarity:104/285 - (36%) Gaps:82/285 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PMELVRVNMQANVIHHSRLSINHMFRLMARHGLPGFYYGI---------VAACLRCTVHT----M 70
            |::.|:..:|:.:            ......|..|.|.|:         .||...||...    :
  Fly    47 PIDTVKTRLQSEL------------GFWRAGGFRGIYKGLAPAAAGSAPTAALFFCTYECGKQFL 99

  Fly    71 STYTLFYNLQDNKYVLMLQPYNTSMVLGITGFWGGVLATPFAKLAVIRQADLT-RGSYER----- 129
            |:.|   ..:|:.||.|... :.:.||..      ::..|   :.:.:|...| :|:.:.     
  Fly   100 SSVT---QTKDSPYVHMAAA-SAAEVLAC------LIRVP---VEIAKQRSQTLQGNKQSGLQIL 151

  Fly   130 -RNYRNFWRGLK-CMYAKGGFTYL---------FTGWKINSISSTAVAVLYTPISDKVHTVISWF 183
             |.||.  .||| .:|...|.|.:         |..|:...:.       :||::.         
  Fly   152 LRAYRT--EGLKRGLYRGFGSTIMREIPFSLIQFPLWEYFKLQ-------WTPLTG--------- 198

  Fly   184 HRLDEPWLSDLITMALTGSIITVIMTPVDALAT---LTLNESSHYGRTSYPYLYRKIIRKHGYKG 245
              .|....|..:..|:.|.|...:.||:|.:.|   |...||.:..|::...|: .|..:.|:.|
  Fly   199 --FDSTPFSVALCGAVAGGISAGLTTPLDVVKTRIMLAERESLNRRRSARRILH-GIYLERGFSG 260

  Fly   246 FFFGWKPALMALIPHTVLATFVYRF 270
            .|.|:.|.::.:   |:...|.:.|
  Fly   261 LFAGFVPRVLWI---TLGGAFFFGF 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 13/74 (18%)
Mito_carr 187..277 CDD:278578 23/87 (26%)
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 11/63 (17%)
PTZ00168 25..281 CDD:185494 58/282 (21%)
Mito_carr 199..291 CDD:278578 23/88 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441874
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.