DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and CG5805

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster


Alignment Length:270 Identity:62/270 - (22%)
Similarity:107/270 - (39%) Gaps:76/270 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SRLSINHMFRLMARHGLPGFYYGIVAACLRCTVHTMSTYTLFYNLQDNKYVLMLQPYNTSMVLGI 99
            |||::       |..|:.|...|  |..:|.....|...|.|:.|.      ||..::....|  
  Fly    10 SRLAV-------APTGVGGAAEG--ATYIRTIEWDMMNKTKFFPLS------MLSSFSVRCCL-- 57

  Fly   100 TGFWGGVLATPFAKLAVIRQADLTRGSYERRNYRNFWRGLKC---MYAKGGFTYLFTGWKINSIS 161
              |...|:.|   :|.|..::|:.:|..:            |   :|...|...|:.|:.|:|:.
  Fly    58 --FPLTVIKT---QLQVQHKSDVYKGMVD------------CAMKIYRSEGVPGLYRGFWISSVQ 105

  Fly   162 STAVAVLYTPISDKVHTVISWF---HRLDEPWLSDLITMALTG----SII-TVIMTPVDALA--T 216
            ..: .|.|....:.|..|::..   ||:          .||.|    |:: ..|:.|.|.::  .
  Fly   106 IVS-GVFYISTYEGVRHVLNDLGAGHRM----------KALAGGGCASLVGQTIIVPFDVISQHA 159

  Fly   217 LTLNESSHYGR---------TSYP---------YLYRKIIRKHGYKGFFFGWKPALMALIPHTVL 263
            :.|..|:|.|.         .|:|         .:.|:|:|:.|::||:.|:..:|||.:|::.:
  Fly   160 MVLGMSAHAGSKGDINPLGIKSWPGRSRLHISMDIGREIMRRDGFRGFYRGYTASLMAYVPNSAM 224

  Fly   264 ATFVYRFLLD 273
            ....|....|
  Fly   225 WWAFYHLYQD 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 13/45 (29%)
Mito_carr 187..277 CDD:278578 26/112 (23%)
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 21/104 (20%)
Mito_carr 132..238 CDD:395101 26/113 (23%)
Mito_carr 245..327 CDD:395101
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441537
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.