DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and Dic1

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster


Alignment Length:279 Identity:84/279 - (30%)
Similarity:137/279 - (49%) Gaps:35/279 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YVGLLIKTTAQLLSHPMELVRVNMQANVIHHSRLSINHMFRLMAR-HGLPGFYYGIVAACLRCTV 67
            :.|.|....|.:::||::|::|.:|....|   ||:..:...:|| .|:..||.|:.|:.||...
  Fly    11 FFGGLASVGAAMVTHPLDLIKVTLQTQQGH---LSVAQLIPKLAREQGVLVFYNGLSASVLRQLT 72

  Fly    68 HTMSTYTLFYNLQDNKYVLMLQPYNTS------MVLGITGFWGGVLATPFAKLAVIRQADLTRGS 126
            ::.:.:.::.  ...|||      ||.      .:.|.:|..||::.||...:.|..|.|:....
  Fly    73 YSTARFGVYE--AGKKYV------NTDSFGGKVALAGASGLVGGIVGTPADMVNVRMQNDVKLPP 129

  Fly   127 YERRNYRNFWRGLKCMYAKGGFTYLFTGWKINSISSTAVAVLYT--PISDKVHTVISWFHRLDEP 189
            .:||||.|.:.||..:|.:.||..||:|    :.::||..:|.|  .|:....|.|   :.|..|
  Fly   130 QQRRNYNNAFDGLVRVYRQEGFKRLFSG----ATAATARGILMTIGQIAFYDQTKI---YLLATP 187

  Fly   190 WLSD-LIT----MALTGSIITVIMTPVDALATLTLNESSHYGRTSYPYLYRKIIRKHGYKGFFFG 249
            :..| |:|    ..:.|:|.|.:..|:|.|.|.::|...  |..:..:...|...|.|..|||.|
  Fly   188 YFQDNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKP--GEFNGLWDIVKHTAKLGPLGFFKG 250

  Fly   250 WKPALMALIPHTVLATFVY 268
            :.||.:.|.|||:: |||:
  Fly   251 YVPAFVRLGPHTII-TFVF 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 20/75 (27%)
Mito_carr 187..277 CDD:278578 29/87 (33%)
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 25/91 (27%)
PTZ00169 13..273 CDD:240302 84/277 (30%)
Mito_carr 89..184 CDD:278578 31/101 (31%)
Mito_carr 189..278 CDD:278578 28/83 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468936
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.