DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and slc25a11

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001002099.1 Gene:slc25a11 / 415189 ZFINID:ZDB-GENE-040625-79 Length:308 Species:Danio rerio


Alignment Length:293 Identity:75/293 - (25%)
Similarity:126/293 - (43%) Gaps:51/293 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AQLLSHPMELVRVNM----QANVIHHSRLSINHMFRLMARHGLPGFYYGIVAACLRCTVHT---M 70
            |.:...|::||:..|    |.:.....:.|.:.:..::...|:.|.|.|:.|..||...:|   :
Zfish    29 ATVFVQPLDLVKNRMQLSGQGSKAREYKTSFHAVGSILRNEGVRGIYTGLSAGLLRQATYTTTRL 93

  Fly    71 STYTLFY---NLQDNKYVLMLQPYNTSM--VLGIT-GFWGGVLATPFAKLAVIRQ-ADLTRGSYE 128
            ..||:.:   :..|.      .|.|..|  ::|:| |..|..:.|| |::|:||. ||......:
Zfish    94 GIYTILFERMSKADG------TPPNFFMKALIGMTAGATGAFVGTP-AEVALIRMTADGRLPPDQ 151

  Fly   129 RRNYRNFWRGLKCMYAKGGFTYLFTGWKINSISSTAVAVL--------YTPISDKVHTVISWFHR 185
            ||.|.|.:..|..:..:.|.|.|:.|    .|.:.|.||:        |:.....:         
Zfish   152 RRGYTNVFNALVRITREEGVTTLWRG----CIPTMARAVVVNAAQLASYSQSKQAL--------- 203

  Fly   186 LDEPWLSDLITMALTGSIITVIMT-----PVDALATLTLNESSHYGRTSYPY---LYRKIIRKHG 242
            ||..:..|.|......|:|:.::|     |||.:.|...|.....|:..|..   :..|:||..|
Zfish   204 LDSGYFRDDILCHFCASMISGLVTTAASMPVDIVKTRIQNMRMIDGKPEYNNGLDVLVKVIRNEG 268

  Fly   243 YKGFFFGWKPALMALIPHTVLATFVYRFLLDRY 275
            :...:.|:.|....|.||||| ||::...::::
Zfish   269 FFSLWKGFTPYYARLGPHTVL-TFIFLEQMNKF 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 17/77 (22%)
Mito_carr 187..277 CDD:278578 27/97 (28%)
slc25a11NP_001002099.1 Mito_carr 18..96 CDD:278578 15/66 (23%)
PTZ00169 19..300 CDD:240302 75/291 (26%)
Mito_carr 110..207 CDD:278578 31/110 (28%)
Mito_carr 213..305 CDD:278578 25/89 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.