DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and GC2

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster


Alignment Length:290 Identity:61/290 - (21%)
Similarity:107/290 - (36%) Gaps:65/290 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 HPMELVRVNMQANVI--HHSRL--SINHMFR-LMARHGLPGFYYG----IVAACLRCTVHTMSTY 73
            :|:::|:..:|...|  :..|:  ||...|| .:|..|..|.|.|    ||.......:...:..
  Fly    39 YPLDMVKTRLQNQTIGPNGERMYTSIADCFRKTIASEGYFGMYRGSAVNIVLITPEKAIKLTAND 103

  Fly    74 TLFYNLQDNKYVLMLQPYNTSMVLGITGFWGGVLATPFAKLAV-------IRQADLTRGSYERRN 131
            ...|:|..:..|:.|.  ..::..|:.|.:..|:.||...|.:       :..||...|      
  Fly   104 FFRYHLASDDGVIPLS--RATLAGGLAGLFQIVVTTPMELLKIQMQDAGRVAAADRAAG------ 160

  Fly   132 YRNFWRGLKCMYAKG---------GFTYLFTGWKINSISSTAVAVLYTPISDKVHTVISWFHRLD 187
                 |.:|.:.|.|         |...|:.|.....:.....:::|.|:       ::|.:  |
  Fly   161 -----REVKTITALGLTKTLLRERGIFGLYKGVGATGVRDITFSMVYFPL-------MAWIN--D 211

  Fly   188 E-PWLSD----------LITMALTGSIITVIMTPVDALATLTLNESSHYGRTSYPYL---YRKII 238
            : |..||          ||...|:|.....::||.|.:.|....:    |...:..:   ..:.:
  Fly   212 QGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQAD----GEKKFKGIMDCVNRTL 272

  Fly   239 RKHGYKGFFFGWKPALMALIPHTVLATFVY 268
            ::.|...||.|....:|.|.|...:|...|
  Fly   273 KEEGISAFFKGGLCRIMVLAPLFGIAQMFY 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 18/71 (25%)
Mito_carr 187..277 CDD:278578 22/96 (23%)
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 56/275 (20%)
Mito_carr 16..106 CDD:278578 16/66 (24%)
Mito_carr 123..203 CDD:278578 16/90 (18%)
Mito_carr 228..302 CDD:278578 17/77 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441928
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.