DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and CG2616

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster


Alignment Length:318 Identity:61/318 - (19%)
Similarity:118/318 - (37%) Gaps:79/318 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PMELVRVNMQA------NVIHHSRLSINHMF-----------------------RLM--ARH-GL 51
            |:::::..||:      ....:|...::|:|                       .||  :|| ||
  Fly   110 PLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRPQFSSSWDALMKISRHEGL 174

  Fly    52 PGFYYGI---VAACLRCTVHTMSTYTLF-----------YN---------LQDNKYVLMLQPYNT 93
            ...:.|:   :.:.|..|:.....|..|           ||         ::|.|..|   |...
  Fly   175 AALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPRHLEIRDTKKSL---PSVV 236

  Fly    94 SMVLGITGFWGGVLATPFAKLAVIRQADLTRGSYERRNYRNFWRGLKCMYAKGGFTYLFTGWKIN 158
            .|:.|:|.....|  |..:.:.::|    |:...:|:.|....:.::.:.|..|...|:.|.:..
  Fly   237 PMMSGVTARICAV--TVVSPIELVR----TKMQAQRQTYAQMLQFVRSVVALQGVWGLWRGLRPT 295

  Fly   159 SISSTAVAVLYTPISDKVHTVISWFHRLDEPWLSDLITMALTGSIITVIMTPVDALAT------- 216
            .:.....:.:|.||.:.:...:.  |.....:....:...:.|::..::.||.|.:.|       
  Fly   296 ILRDVPFSGIYWPIYESLKQNLG--HGSQPSFSLSFLAGVMAGTVAAIVTTPFDVVKTHEQIEFG 358

  Fly   217 ----LTLNESSHYGRTSYPYLYRKIIRKHGYKGFFFGWKPALMALIP--HTVLATFVY 268
                .|.:.:..:|:.|.......|.|.||.:|.|.|..|.|:.:.|  ..:::||.|
  Fly   359 ERVIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLKVAPACAIMISTFEY 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 19/116 (16%)
Mito_carr 187..277 CDD:278578 21/95 (22%)
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 17/96 (18%)
Mito_carr 230..321 CDD:278578 19/101 (19%)
Mito_carr 321..425 CDD:278578 21/96 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441460
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.