DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and Dic4

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster


Alignment Length:270 Identity:71/270 - (26%)
Similarity:119/270 - (44%) Gaps:38/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PMELVRVNMQANVIHHSRLSINHMFRLMARHGLPGFYYGIVAACLRCTVHTMSTYTLFYNLQDNK 83
            |:::|:.:||  :....|..:..:.|:.:..|..|||.|..||.||....|...:.::...:..:
  Fly    39 PIDIVKTHMQ--IQRQKRSILGTVKRIHSLKGYLGFYDGFSAAILRQMTSTNIHFIVYDTGKKME 101

  Fly    84 YVLMLQPYNTSMVLG-ITGFWGGVLATPFAKLAVIRQADLTRGSYERRNYRNFWRGL-------- 139
            || ....|...::|| :.|..|.....|...:.|..|.|:....|:||||::.:.||        
  Fly   102 YV-DRDSYLGKIILGCVAGACGSAFGIPTDLINVRMQTDMKEPPYKRRNYKHVFDGLIRIPKEEG 165

  Fly   140 -KCMYAKGGFTYLFTGWKINSISSTAVAVLYTPISDKVHTVISWFHRLDEPWLSDLITMALTGSI 203
             |.:| |||...:|.    :|:|:.:....|..|..:|...||....|...:|:.|.|     ||
  Fly   166 WKALY-KGGSVAVFK----SSLSTCSQIAFYDIIKTEVRKNISVNDGLPLHFLTSLGT-----SI 220

  Fly   204 ITVIMT-PVDALATLTLNESSHYGRTSYPYLYRKIIR------KHGYKGFFFGWKPALMALIPHT 261
            |:..:| |:|.:.|:.:|        |.|..:|.:.:      :.|..|.:.|:.|.::...|.|
  Fly   221 ISSAITHPLDVVRTIMMN--------SRPGEFRTVFQASVHMMRFGVMGPYRGFVPTIVRKAPAT 277

  Fly   262 VLATFVYRFL 271
            .|...:|..|
  Fly   278 TLLFVLYEQL 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 16/61 (26%)
Mito_carr 187..277 CDD:278578 23/92 (25%)
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 71/270 (26%)
Mito_carr 26..100 CDD:278578 16/62 (26%)
Mito_carr 104..201 CDD:278578 27/101 (27%)
Mito_carr 211..292 CDD:278578 23/90 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468933
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.