DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and slc25a30

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001165746.1 Gene:slc25a30 / 394840 XenbaseID:XB-GENE-995074 Length:291 Species:Xenopus tropicalis


Alignment Length:313 Identity:66/313 - (21%)
Similarity:119/313 - (38%) Gaps:77/313 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PVYVGLLIKTTAQLLSHPMELVRVNM----QANVIHHSRLSINHMF----RLMARHGLPGFYYGI 58
            |...|.|...||:..:.|::|.:..:    |||...:..:....|.    |:....|:...|.||
 Frog     8 PFIYGGLASITAECGTFPIDLTKTRLQVQGQANDAKYKEIRYRGMLHAIVRIWKEEGVKALYSGI 72

  Fly    59 VAACLRCTVH---TMSTYTLFYNLQDNKYVLMLQPYNTSMVLGI-TGFWGGVLA------TPFAK 113
            ..|.||...:   .:.||      |..|.:.:..|.:.::|:.: .|...||::      |...|
 Frog    73 APAMLRQASYGTIKIGTY------QSLKRLFVDCPEDETLVINVFCGVLSGVVSSCIANPTDVLK 131

  Fly   114 LAVIRQADLTRGS--------YERRNYRNFWRGLKCMYAKGGFTYLFTGWKINSISSTAVAVLY- 169
            :.:..|..|.:|.        |::...|..|:|:                   |:::...|::. 
 Frog   132 IRMQAQGSLIQGGMIGNFINIYQQEGTRGLWKGV-------------------SLTAQRAAIVVG 177

  Fly   170 --TPISD--KVHTVIS-------WFHRLDEPWLSDLITMALTGSIITVIMTPVDALATLTLNESS 223
              .|:.|  |.|.::|       :.|.|..      .|..|.|::.:   .|||.:.|..:|:.|
 Frog   178 VELPVYDITKKHLILSGLMGDTVYTHFLAS------FTCGLAGALAS---NPVDVVRTRMMNQRS 233

  Fly   224 --HYGRTSYPYLYRKIIRKHGYKGFFF---GWKPALMALIPHTVLATFVYRFL 271
              :...:||......:::....:|||.   |:.|..:.|.|..::....|..|
 Frog   234 IRNVSNSSYKGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFITYEQL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 20/85 (24%)
Mito_carr 187..277 CDD:278578 20/90 (22%)
slc25a30NP_001165746.1 Solcar 1 7..96 23/93 (25%)
PTZ00169 9..289 CDD:240302 65/312 (21%)
Solcar 2 104..189 18/103 (17%)
Solcar 3 198..289 22/98 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.