DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and SCaMC

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster


Alignment Length:317 Identity:54/317 - (17%)
Similarity:103/317 - (32%) Gaps:113/317 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PMELVRVNMQANVIHHSRLSINHMFRLMARHG--------------------------------- 50
            |::.::|.:|   :...|:.|:....:|...|                                 
  Fly   305 PLDRIKVYLQ---VQTQRMGISECMHIMLNEGGSRSMWRGNGINVLKIAPETAFKFAAYEQMKRL 366

  Fly    51 ------------LPGFYYGIVAACLRCTVHTMSTYTLFYNLQDNKYVLMLQPYNTSMVLGITGFW 103
                        :..||.|..|..:        :.|:.|.::..|         |.:.|..||.:
  Fly   367 IRGDDGSRQMSIVERFYAGAAAGGI--------SQTIIYPMEVLK---------TRLALRRTGQY 414

  Fly   104 GGVLATPFAKLAVIRQADLTRGSYERRNYRNFWRGLKCMYAKGGFTYLFTGWKINSISSTAVAVL 168
            .|:             ||.....|::...|:|:||           |:.....|...:...:|| 
  Fly   415 AGI-------------ADAAVKIYKQEGVRSFYRG-----------YVPNILGILPYAGIDLAV- 454

  Fly   169 YTPISDKVHTVISWFHRLDEPWLSDLITMALTGSI--------ITVIMTPVDALATLTL------ 219
            |..:..:   .|:.....::|....|:....|.|.        :.::.|.:.|.|..|:      
  Fly   455 YETLKRR---YIANHDNNEQPSFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRK 516

  Fly   220 ------NESSHYGRTSYPYLYRKIIRKHGYKGFFFGWKPALMALIPHTVLATFVYRF 270
                  :..:|.|..:...|:|||:|:.|..|.:.|..|..:.::|...::..||.:
  Fly   517 TQIPLKSSDAHSGEETMTGLFRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYEY 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 13/106 (12%)
Mito_carr 187..277 CDD:278578 22/104 (21%)
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 7/67 (10%)
Mito_carr 375..463 CDD:278578 24/132 (18%)
Mito_carr 470..581 CDD:278578 22/104 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441964
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.