DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and slc25a27

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_956635.1 Gene:slc25a27 / 393312 ZFINID:ZDB-GENE-040426-1290 Length:315 Species:Danio rerio


Alignment Length:298 Identity:55/298 - (18%)
Similarity:107/298 - (35%) Gaps:60/298 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AQLLSHPMELVRVNMQANVIHHS------------RLSINHMFRLMARHGLPGFYYGIVAACLRC 65
            |:|::.|::|.:..:|......|            |..::....::...|....:.|:..|..|.
Zfish    26 AELVTFPLDLTKTRLQIQGEGRSGKNGGSVQTQKYRGMLSTAAGIVREEGPLKLWQGVTPAIYRH 90

  Fly    66 TVHTMSTYTLFYNLQDNKYVLMLQPYNTSMVLG-----------------ITGFWGGVLATPFAK 113
            .|::......:..::::             |||                 |:|..|..:|:|...
Zfish    91 IVYSGGRMLAYEQMRES-------------VLGKSEDGIFPVWKAVIASMISGALGQFIASPTDL 142

  Fly   114 LAVIRQADLTR---GSYERRNYRNFWRGLKCMYAKGGFTYLFTGWKINSISSTAVAVLYTPISDK 175
            :.|..|.:..|   |...|  .|..:.....:.|:||...|:.||..|...:..|.:......|.
Zfish   143 VKVQMQMEGRRRLEGKPPR--VRGVYHAFTKIVAQGGIRGLWAGWVPNVQRAALVNLGDLMTYDT 205

  Fly   176 VHTVISWFHRLDEPWLSDLITMALTGSIITVIMTPVDALATLTLNE-SSHYGRTSYPYLYR---- 235
            |...:.....:.:..:...::...:|.:...:.||.|.:.|..:|: ....||   ..|||    
Zfish   206 VKHFLLRNTSIPDNSICHGLSSICSGLVAATMGTPADVVKTRVMNQPRDSNGR---GLLYRNSTD 267

  Fly   236 ---KIIRKHGYKGFFFGWKPALMALIPHTVLATFVYRF 270
               :.:|:.|:...:.|:.|....:.|.::  ||...|
Zfish   268 CLVQSVRREGFFSLYKGFLPTWFRMAPWSL--TFWLTF 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 12/79 (15%)
Mito_carr 187..277 CDD:278578 19/92 (21%)
slc25a27NP_956635.1 Mito_carr 13..112 CDD:278578 15/98 (15%)
PTZ00169 16..310 CDD:240302 55/298 (18%)
Mito_carr 118..213 CDD:278578 21/96 (22%)
Mito_carr 217..311 CDD:278578 19/92 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.