DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and CG18418

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster


Alignment Length:307 Identity:68/307 - (22%)
Similarity:132/307 - (42%) Gaps:68/307 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPVYVGLLIKTTAQLLS----HPMELVRVNMQANVIHHSR---LSINHMFRLMARHGLPGFYYGI 58
            :|.::..::..|:.:|:    .|::|::..||.:....:|   .|...:.:::...|:...|.|:
  Fly    12 VPTHMKFVMGGTSGMLATCIVQPLDLLKTRMQISGTLGTREYKNSFEVLSKVLKNEGILSLYNGL 76

  Fly    59 VAACLRCTVHT---MSTYTL---FYNLQDNKYVLMLQPYNTSMVLGI-TGFWGGVLATPFAKLAV 116
            .|..||...:|   |..|.:   :|......|..|:    .||.:|| .|.:|.:...| |::|:
  Fly    77 SAGLLRQATYTSAKMGVYQMELDWYRKNFGNYPSMV----ASMTMGIVAGAFGAMCGNP-AEVAL 136

  Fly   117 IR-QADLTRGSYERRNYRN----------------FWRGLKCMYAKGGFTYLFTGWKINSISSTA 164
            || .:|......:||||:|                .|||  |:...|      ....:|.:...:
  Fly   137 IRMMSDNRLMPEDRRNYKNVGDAFVRIVKDEGVVALWRG--CLPTVG------RAMVVNMVQLAS 193

  Fly   165 VAVLYTPISDKVHTVISWFHRLDEPWLSDLITMALTGSIITVIMT-----PVDALATLTLNESSH 224
                |:.:.:::|           .:||:.|.:.||.::::.::|     |:|...|........
  Fly   194 ----YSLMKNQLH-----------GYLSEGIPLHLTAALVSGLLTSVTSMPLDMAKTRIQQMKVI 243

  Fly   225 YGRTSYP---YLYRKIIRKHGYKGFFFGWKPALMALIPHTVLATFVY 268
            .|:..|.   .:.:|:::..|....:.|:.|.||.:.|||:. :||:
  Fly   244 DGKPEYSGTIDVLKKVLKNEGAFAVWKGFTPYLMRMGPHTIF-SFVF 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 18/87 (21%)
Mito_carr 187..277 CDD:278578 22/90 (24%)
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 19/95 (20%)
PTZ00169 18..296 CDD:240302 67/301 (22%)
Mito_carr 109..205 CDD:278578 26/123 (21%)
Mito_carr 208..300 CDD:278578 20/83 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441909
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.