DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and CG7514

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster


Alignment Length:302 Identity:68/302 - (22%)
Similarity:120/302 - (39%) Gaps:65/302 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPVYV----GLLIKTTAQLLSHPMELVRVNMQAN-VIHHSRLSINHMFRLMARHGLPGFYYGIVA 60
            :|.|:    |.|.......:..|::||:..||.: .....:.|.:.:.::....|:...|.|:.|
  Fly    10 IPGYMMYINGGLAGMLGTCIVQPLDLVKTRMQISATTGEYKSSFDCLLKVFKNEGILALYNGLSA 74

  Fly    61 ACLRCTVHTMSTYTL----FYNLQDNKYVLMLQPYN------TSMVLGI-TGFWGGVLATPFAKL 114
            ..:|     .:|||.    ||.::.:.|   .:.:|      .||.:|| .|.:|.:...| |::
  Fly    75 GLMR-----QATYTTARMGFYQMEIDAY---RKQFNAPPTVLASMGMGILAGAFGAMFGNP-AEV 130

  Fly   115 AVIR-QADLTRGSYERRNYR----------------NFWRGLKCMYAKGGFTYLFTGWKINSISS 162
            |:|| .:|......|||||.                ..|:|  ||...|      ....:|.:..
  Fly   131 ALIRMMSDNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKG--CMPTVG------RAMIVNMVQL 187

  Fly   163 TAVAVLYTPISDKVHTVISWFHRLDEPWLSDLITMALTGSIITVIMTPVDALAT-LTLNESSHYG 226
            .:.:.|....|:       :|..|.    ..:....::|.:.|:...|:|...| :...:::.|.
  Fly   188 ASYSQLKAAFSE-------YFSGLS----LHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAEYK 241

  Fly   227 RTSYPYLYRKIIRKHGYKGFFFGWKPALMALIPHTVLATFVY 268
            .|.  .:..|:.:..|....:.|:.|.|..|.||||.| |::
  Fly   242 GTM--DVLMKVSKNEGIASLWKGFTPYLCRLGPHTVFA-FIF 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 18/79 (23%)
Mito_carr 187..277 CDD:278578 19/83 (23%)
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 66/296 (22%)
Mito_carr 19..90 CDD:278578 16/75 (21%)
Mito_carr 104..201 CDD:278578 25/112 (22%)
Mito_carr 207..284 CDD:278578 19/77 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441908
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.