DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and PMP34

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster


Alignment Length:270 Identity:63/270 - (23%)
Similarity:104/270 - (38%) Gaps:36/270 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 HPMELVRVNMQANVIHHSRLSINHMFRLMARHGLPGFYYG----IVAACLRCTVHTMSTYTLFYN 78
            :|::.||..:|.......|.:...:..::...|....|.|    :.:.|:       |.:..||.
  Fly    34 YPLDTVRSRLQLEEAGDVRSTRQVIKEIVLGEGFQSLYRGLGPVLQSLCI-------SNFVYFYT 91

  Fly    79 LQDNKYVLM-LQPYNTS----MVLG-ITGFWGGVLATPFAKLAV-IRQADLTRGSYE-RRNYRNF 135
            ....|.|.. ..|...|    ::|| |.|....:..|||..:.. :|..::...|.| .::|:|.
  Fly    92 FHALKAVASGGSPSQHSALKDLLLGSIAGIINVLTTTPFWVVNTRLRMRNVAGTSDEVNKHYKNL 156

  Fly   136 WRGLKCMYAKGGFTYLFTGWKINSISSTAVAVLYTPISDKVHTVISWFHRLDEPWLSDLITMALT 200
            ..|||.:..|.|...|::| .|.|:...:...|...:.:.:...|..|...:...||.....|:.
  Fly   157 LEGLKYVAEKEGIAGLWSG-TIPSLMLVSNPALQFMMYEMLKRNIMRFTGGEMGSLSFFFIGAIA 220

  Fly   201 GSIITVIMTPVDALATLTLNE--------SSHYGRT----SYPYLYRKIIRKHGYKGFFFGWKPA 253
            .:..||:..|:..:.|...:.        |:..|.|    |...|...|::..|.:|.|.|    
  Fly   221 KAFATVLTYPLQLVQTKQRHRSKESDSKPSTSAGSTPRTESTLELMISILQHQGIRGLFRG---- 281

  Fly   254 LMALIPHTVL 263
            |.|.|..|||
  Fly   282 LEAKILQTVL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 12/66 (18%)
Mito_carr 187..277 CDD:278578 23/89 (26%)
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 12/68 (18%)
Mito_carr 105..202 CDD:278578 24/97 (25%)
Mito_carr 214..303 CDD:278578 21/82 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441886
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.