DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and Tpc2

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster


Alignment Length:303 Identity:62/303 - (20%)
Similarity:114/303 - (37%) Gaps:49/303 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GLLIKTTAQLLSHPMELVRVNMQAN---VIHH---SRLSINHMFR-LMARHGLPGFYYGIVAACL 63
            |.:.....:.::.|::::::..|..   |.:|   ....:.|.|: :.|..|:.|.:.|..:..:
  Fly    16 GGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSVYAEEGMRGMFRGHNSGQV 80

  Fly    64 RCTVHTMSTYTLFYNLQDNKYVL---MLQPYNTSMVL-GITGFWGGVLATPFAKLAVIRQADLTR 124
            ....:.:..:..:..|:...:..   ..:|:....:. ||.|..|.|.|.||   .|:|...:..
  Fly    81 LSISYALVQFWSYEQLRSMAHQFDYWRERPFLMFFICGGIAGCLGAVAAQPF---DVVRTQMVAA 142

  Fly   125 GSYERRNYRNFWRGLKCMYAKGGFTYLFTGWKINSISSTAV-------------AVLYTPISDKV 176
            ....||:..|.:.||:.:|...|:..|..|.....:....:             |||.....|:.
  Fly   143 DPSSRRSQMNTFTGLRKVYKMEGWMGLSRGLPFTLVQVFPLVGANFLFYKYLNAAVLMAKPPDQR 207

  Fly   177 HTVISWFHRLDEPWLSDLITMALTGSIITVIMTPVDAL-ATLTL----NESSHYGRT-SYPYLYR 235
            ..:...|..|:.         ||:|.:..:|:.|.|.| ..:.|    .|...:||. ..|.:..
  Fly   208 QEIHGAFLFLNG---------ALSGVLAKMIVYPADLLKKRIQLMAFKQERKTFGRNPECPTILG 263

  Fly   236 KI---IRKHGYKGFFFGWKPALMALIPHTVLATFVYRFLLDRY 275
            .|   .|:.|..||:.|..|.|:    ...|.:.||..:.|.:
  Fly   264 CITTTFREEGIGGFYKGMLPTLL----KAGLMSAVYFSIYDMF 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 12/81 (15%)
Mito_carr 187..277 CDD:278578 24/98 (24%)
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 61/296 (21%)
Mito_carr 23..99 CDD:278578 11/75 (15%)
Mito_carr 108..194 CDD:278578 20/88 (23%)
Mito_carr 216..307 CDD:278578 25/100 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441585
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.