DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and Shawn

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster


Alignment Length:308 Identity:52/308 - (16%)
Similarity:86/308 - (27%) Gaps:144/308 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPVYVGLLIKTTAQLLS----HPMELVRVNMQANVIHHSRLSINHMFRLMARHGLPGFYYGIVAA 61
            :|..|.||...:.::|:    .|:||:|..||:..:.|:.:                  :|.:  
  Fly   179 IPFLVPLLAGVSGRILAVTCVSPVELIRTKMQSQRMTHAEM------------------FGTI-- 223

  Fly    62 CLRCTVHTMSTYTLFYNLQDNKYVLMLQPYNTSMVLGITGFWGGVLAT-----PFAKLAVIRQAD 121
                                 :.|:..|        |:.|.|.|:..|     ||:.:       
  Fly   224 ---------------------RQVVQSQ--------GVLGLWRGLPPTILRDVPFSGI------- 252

  Fly   122 LTRGSYERRNYRNFWRGLKCM-YAKGGFTYLFTGWKINSISSTAVAVLYTPISDKVHTVISWFHR 185
                         :|   .|. |.|..|..:                                  
  Fly   253 -------------YW---TCYEYLKSSFGVV---------------------------------- 267

  Fly   186 LDEPWLS-DLITMALTGSIITVIMTPVDALATLTLNESSHYGR--------------TSYPYLYR 235
              ||..| .....|::||:...|.||.|.:.|   :|...:|.              .|......
  Fly   268 --EPTFSFSFAAGAISGSVAATITTPFDVVKT---HEQIEFGEKFIFSDNPPKQVATKSVAMRLA 327

  Fly   236 KIIRKHGYKGFFFGWKPALMALIPHTVL--------ATFVYRFLLDRY 275
            .|.|..|....|.|..|.|..:.|...:        .:|.|.:.:|::
  Fly   328 SIYRMGGVPAIFSGLGPRLFKVAPACAIMISSFEYGKSFFYHYNIDQH 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 11/78 (14%)
Mito_carr 187..277 CDD:278578 25/112 (22%)
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578
Mito_carr 178..265 CDD:278578 26/157 (17%)
Mito_carr 268..371 CDD:278578 24/105 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441454
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.