DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and Tyler

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster


Alignment Length:381 Identity:66/381 - (17%)
Similarity:122/381 - (32%) Gaps:131/381 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VGLLIKTTAQLLSHPMELVRVNMQAN-------------VIHHSRLSINHMFR------------ 44
            ||.||.|   .:..|:|:|:..:|..             .::|:.| :.|:.|            
  Fly    54 VGGLITT---FVVTPLEVVKTRVQTQHAIRQRPTVSKLCYVYHNGL-MTHVCRSSDICVPKPGRD 114

  Fly    45 ----------------LMARHGLPGFYYGI---VAACLRCTVHTMSTYTLFYNLQDNKYVLMLQ- 89
                            ::...|..|.:.|:   :.:.|..|:....||....|...:.|::..: 
  Fly   115 PQNLRPLRGAMDAFVKIVCTSGFSGLWAGLSPTLVSALPSTIIYFLTYEYIKNSLSHIYLVSQKF 179

  Fly    90 --------------------------------------PYNTSMVLGITGFWGGVLATPFAKLAV 116
                                                  ||...|..||..  ..::.|....:.:
  Fly   180 EESGMKDQVPGADGGDPLDQATRGINVSATAPVSTASLPYYVPMASGICS--RTIVVTAITPIEM 242

  Fly   117 IRQADLTRGSYERRNYRNFWRGLKCMYAKGGFTYLFTGWKINSISSTAVAVLYTPISDKVHTVIS 181
            :|    .:...|...|...||.|:.:..:.|...|:.||....:.....:..|..:.:.:....|
  Fly   243 VR----IKMQSEYMTYAELWRVLRSLIRQHGILGLWRGWPPTVMRDAPFSGTYWAVYEAIKRAFS 303

  Fly   182 WFHRLDEP-WLSDLITMALTGSIITVIMTPVDALATLT---LNESSHY----------------- 225
                :.|| :|...:|.|::|::.|.:..|.|.:.|.|   |.:...|                 
  Fly   304 ----VTEPTFLFSFLTGAISGAVATFVTMPFDLITTHTQIELGQDVLYEEIGAGTGAGTGTGAGA 364

  Fly   226 -----------GRTSYPYLYRKIIRKHGYKGFFFGWKPALMALIP--HTVLATFVY 268
                       .|.|.....|:|.|..|.:|.:.|..|.::.::|  ..:::||.|
  Fly   365 RPKTPQSAVANSRPSVLSRMRQIYRLQGVRGLYVGVMPRMLRVVPACAIMISTFEY 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 20/118 (17%)
Mito_carr 187..277 CDD:278578 26/116 (22%)
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 21/120 (18%)
Mito_carr 216..302 CDD:278578 17/91 (19%)
Mito_carr 306..429 CDD:278578 26/115 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441466
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.