DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and sea

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster


Alignment Length:285 Identity:54/285 - (18%)
Similarity:101/285 - (35%) Gaps:47/285 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LSHPMELVRVNMQANVIHHSRLSINHMF----RLMARHGLPGFYYGIVAACLRCTVHTMSTYTLF 76
            :::|.|.|:..:|.:....:: ..|.:|    :.:...|..|.|.|:..........:.:.:..|
  Fly    50 ITYPTEYVKTQLQLDEKGAAK-KYNGIFDCVKKTVGERGFLGLYRGLSVLVYGSIPKSAARFGAF 113

  Fly    77 YNLQDNKYVLMLQPYNTSMVLGITGFWGG-----VLATPFAKLAVIRQADLTRGSYERRNYRNFW 136
            ..|:.|......|..|:..:|  .|...|     |..||...:.|....|...|:   ..:|.|.
  Fly   114 EFLKSNAVDSRGQLSNSGKLL--CGLGAGVCEAIVAVTPMETIKVKFINDQRSGN---PKFRGFA 173

  Fly   137 RGLKCMYAKGGFTYLFTGWKINSISSTAVAVLYTP--ISDKVHTVISWF-------------HRL 186
            .|:..:....|.:.::.|              .||  :....:..|.:|             |..
  Fly   174 HGVGQIIKSEGISGIYKG--------------LTPTILKQGSNQAIRFFVLESLKDLYKGDDHTK 224

  Fly   187 DEPWLSDLITMALTGSIITVIMTPVDALATLTLN-ESSHYGRTSYPYLYRKIIRKHGYKGFFFGW 250
            ..|.|...:..|:.|:......||:|.:.|.... |:|.|..|::..:  :|::..|...|:.|.
  Fly   225 PVPKLVVGVFGAIAGAASVFGNTPLDVVKTRMQGLEASKYKNTAHCAV--EILKNEGPAAFYKGT 287

  Fly   251 KPALMALIPHTVLATFVYRFLLDRY 275
            .|.|..:.....:...:|...:|.:
  Fly   288 VPRLGRVCLDVAITFMIYDSFMDLF 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 12/68 (18%)
Mito_carr 187..277 CDD:278578 20/90 (22%)
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 52/273 (19%)
Mito_carr 34..117 CDD:278578 11/67 (16%)
Mito_carr 125..220 CDD:278578 20/113 (18%)
Mito_carr 235..314 CDD:278578 18/80 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441916
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.