DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and CG18324

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster


Alignment Length:314 Identity:64/314 - (20%)
Similarity:110/314 - (35%) Gaps:78/314 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AQLLSHPMELVRVNMQ--------ANVIHHSRLSINHMFRLMARHGL--------PGFYYGIVAA 61
            |.:.::|:::|:..||        ...:...|.....|.:::...||        |...|..|..
  Fly    16 AVVFTNPIDVVKTRMQLQGELAARGTYVKPYRHLPQAMLQIVLNDGLLALEKGLAPALCYQFVLN 80

  Fly    62 CLRCTVHTMSTYTLFYNLQDNKYVLMLQPYNTSMVLG-ITGFWGGVLATPFAKLAVIRQA----- 120
            .:|.:|::.:....:....|...     .:...|..| :.|..|...|:||..:...:.|     
  Fly    81 SVRLSVYSNALELGYLQNADGSI-----SFYRGMFFGALGGCTGTYFASPFYMIKAQQHAQAVQS 140

  Fly   121 -------------DLTRGSYERRNYRNFWRGLKCMYAKGGFTYLFTGWKINSISSTAVA-VLYTP 171
                         |.....|.......|||.                 .:.|::.|.|| .:...
  Fly   141 IAVGFQHKHTSMMDALLHIYRTNGISGFWRA-----------------ALPSLNRTLVASSVQIG 188

  Fly   172 ISDKVHTVISWFHRLDEPWLSDLITMAL-----TGSIITVIMTPVDALATLTLNES-SHYGR-TS 229
            ...|..:::.     |:.|::..:.::.     :|:::.|..:|.|.|.|...|:. ...|| ..
  Fly   189 TFPKAKSLLK-----DKGWITHPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLM 248

  Fly   230 YPYL---YRKIIRKHGYKGFFFGWKPALMALIPHTVLATFVY----RFLLDRYI 276
            |..|   :.||.|..|..|.:.|:.|......|||.| |||:    ..|.|||:
  Fly   249 YKGLVDCFTKIWRTEGIHGMYKGFWPIYFRSAPHTTL-TFVFFEKLLHLRDRYV 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 14/83 (17%)
Mito_carr 187..277 CDD:278578 31/104 (30%)
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 13/70 (19%)
PTZ00169 5..293 CDD:240302 60/304 (20%)
Mito_carr 101..201 CDD:278578 19/126 (15%)
Mito_carr 204..296 CDD:278578 25/92 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441319
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.