DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and CG8323

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster


Alignment Length:318 Identity:64/318 - (20%)
Similarity:112/318 - (35%) Gaps:89/318 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VGLLIKTTAQLLSHPMELVRVNMQ--------ANVIHHSRLSINHMFRLMARHGLPGFYYGIVAA 61
            :|.|....|...::|:|:::..:|        ...:...:..:|....:....|:.|...|:..|
  Fly     8 LGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKGLAPA 72

  Fly    62 CLRCTVHTMSTYTLFYNLQDNKYVLMLQPYNTSM------------VLGITGFWGGV-------L 107
                         |::....|.:.|.:  |:.:|            ..|:...||.:       .
  Fly    73 -------------LYFQFIINSFRLSI--YSEAMERRWMHNRKGEVSYGMGLLWGAIGGVVGCYF 122

  Fly   108 ATPF------------AKLAVIRQ------ADLTRGSYERRNYRNFWRGLKCMYAKGGFTYLFTG 154
            ::||            .::||..|      .|..|..|.|...|..|||......:..   |.:|
  Fly   123 SSPFFLIKTQLQSQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAA---LGSG 184

  Fly   155 WKINSISST-AVAVLYTPISDKVHTVISWFHRLDEPWLSDLITMALTGSIITVIMTPVDALATLT 218
            .:|.:...| |:.|.|..::              :|.|:......:.|||::|.:||.|.:.|..
  Fly   185 AQIATFGKTKALLVQYDLVT--------------QPTLNSFSAGLIAGSIMSVAITPPDVITTRL 235

  Fly   219 LNES-SHYGRTSYPYLYR-------KIIRKHGYKGFFFGWKPALMALIPHTVLATFVY 268
            .|:. ...||   ..|||       ||:|..|..|.:.|:....:.:.||:.|....:
  Fly   236 YNQGVDAEGR---GLLYRGWLDCFVKILRSEGVYGMYKGFWANYLRIAPHSTLVLLFF 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 12/82 (15%)
Mito_carr 187..277 CDD:278578 25/90 (28%)
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 14/93 (15%)
PTZ00169 5..293 CDD:240302 64/318 (20%)
Mito_carr 101..200 CDD:278578 22/101 (22%)
Mito_carr 206..301 CDD:278578 25/88 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441313
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.