DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and Slc25a30

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001013205.1 Gene:Slc25a30 / 361074 RGDID:1359702 Length:291 Species:Rattus norvegicus


Alignment Length:321 Identity:67/321 - (20%)
Similarity:119/321 - (37%) Gaps:93/321 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PVYVGLLIKTTAQLLSHPMELVRVNMQA---------NVIHHSRLSINHMFRLMARHGLPGFYYG 57
            |...|.|...||:..:.|::|.:..:|.         ..|.: |..::.:.|:....||...|.|
  Rat     8 PFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFREIRY-RGMLHALMRIGREEGLRALYSG 71

  Fly    58 IVAACLRCTVH---TMSTYTLFYNLQDNKYVLMLQPYNTSMVLGIT-GFWGGVLATPFA------ 112
            |..|.||...:   .:.||      |..|.:.:.:|.:.::::.:. |...||:::..|      
  Rat    72 IAPAMLRQASYGTIKIGTY------QSLKRLAVERPEDETLLINVVCGILSGVISSAIANPTDVL 130

  Fly   113 KLAVIRQADLTRGS--------YERRNYRNFWRGLKCMYAKGGFTYLFTGWKINSISSTAVAVLY 169
            |:.:..|....:|.        |::...|..|:|:                   |:::...|::.
  Rat   131 KIRMQAQNSAVQGGMIGNFISIYQQEGTRGLWKGV-------------------SLTAQRAAIVV 176

  Fly   170 ---TPISD--KVHTVISWF--HRLDEPWLSDLITMALTGSIITVIMTPVDALATLTLNESS-HYG 226
               .|:.|  |.|.::|..  ..:...:||. .|..|.|::.:   .|||.:.|..:|:.. ..|
  Rat   177 GVELPVYDITKKHLILSGLMGDTVSTHFLSS-FTCGLVGALAS---NPVDVVRTRMMNQRDLRDG 237

  Fly   227 RTSYPYLYRKIIRKHGYK-------------GFFF---GWKPALMALIPHTVLATFVYRFL 271
            |.|            |||             |||.   |:.|..:.|.|..::....|..|
  Rat   238 RCS------------GYKGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFLTYEQL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 20/86 (23%)
Mito_carr 187..277 CDD:278578 25/102 (25%)
Slc25a30NP_001013205.1 Solcar 1 7..96 23/94 (24%)
PTZ00169 9..289 CDD:240302 66/320 (21%)
Solcar 2 104..189 16/103 (16%)
Solcar 3 198..289 25/105 (24%)
Mito_carr 199..289 CDD:395101 25/104 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.