DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and CG8026

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster


Alignment Length:304 Identity:64/304 - (21%)
Similarity:109/304 - (35%) Gaps:76/304 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLSHPMELVRVNMQAN------VIHHSRLS--INHMFRLMARHGLPGFYYGIVAACLRCTVHTMS 71
            |:.||::|:::....|      |..:..||  ...:||   :.|..|.|.|:       |.:...
  Fly    38 LILHPLDLIKIRFAVNDGRTATVPQYRGLSSAFTTIFR---QEGFRGLYKGV-------TPNVWG 92

  Fly    72 T------YTLFYNLQDNKYVLMLQPYNTSMVLGIT---------GFWGGVLATPF--AKLAVIRQ 119
            :      |.:||    |.....:|..||:|.||.|         |....:|..|.  .|..:..|
  Fly    93 SGSSWGLYFMFY----NTIKTFIQGGNTTMPLGPTMNMLAAAESGILTLLLTNPIWVVKTRLCLQ 153

  Fly   120 ADLTRGSYERRNYRNFWRGLKCMYAKGGFTYLFTGWKINSISSTAVAVLY--------------- 169
            .|....:    .||.....|..:|.:.|...|:.|:....:..:..|:.:               
  Fly   154 CDAASSA----EYRGMIHALGQIYKEEGIRGLYRGFVPGMLGVSHGAIQFMTYEELKNAYNEYRK 214

  Fly   170 TPISDKVHTVISWFHRLDEPWLSDLITMALTGSIITVIMTPVDALATLTLNESSHYGRTSYPYLY 234
            .||..|:.|             ::.:..|....:|....|....:....|.:..|....::..: 
  Fly   215 LPIDTKLAT-------------TEYLAFAAVSKLIAAAATYPYQVVRARLQDHHHRYNGTWDCI- 265

  Fly   235 RKIIRKHGYKGFFFGWKPALMALIPHTVLATFVY----RFLLDR 274
            ::..|..||:||:.|.|.:|..::|..::...||    .|||.|
  Fly   266 KQTWRFEGYRGFYKGLKASLTRVVPACMVTFLVYENVSHFLLAR 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 18/79 (23%)
Mito_carr 187..277 CDD:278578 20/92 (22%)
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 57/280 (20%)
Mito_carr 23..115 CDD:278578 20/90 (22%)
Mito_carr 119..213 CDD:278578 17/97 (18%)
Mito_carr 220..307 CDD:278578 19/100 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441776
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.