DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and CG4995

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster


Alignment Length:287 Identity:58/287 - (20%)
Similarity:103/287 - (35%) Gaps:42/287 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GLLIKTTAQLLSHPMELVRVNMQANVIHHSRL-SINHMFR-LMARHGLPGFYYGIVAACLRCTVH 68
            |||......|:.||.:.|:|::|.:...:.:. ...|.|| ::.|....|.|.||.:......:.
  Fly    47 GLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTFHCFRTIVQRDKFIGLYRGISSPMGGIGLV 111

  Fly    69 TMSTYTLFYNLQ--DNKYVLMLQPYNTSMVLGIT-GFWGGVLATPFAKLAVIRQAD--------- 121
            ....:.::.|:|  .|....:...:....:.|:. ||....:.....:|.:..|.|         
  Fly   112 NAIVFGVYGNVQRLSNDPNSLTSHFFAGSIAGVAQGFVCAPMELAKTRLQLSTQVDSGIKFTGPI 176

  Fly   122 -LTRGSYERRNYRNFWRGLKCMYAKG--GFTYLFTGWK--INSISSTAVAVLYTPISDKVHTVIS 181
             ..:...:....|..::||.....:.  ||...|..::  :..:.:..||  ||.::.....:.|
  Fly   177 HCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYLMRQVETPGVA--YTLMAGGCAGMSS 239

  Fly   182 WFHRLDEPWLSDLITMALTGSIITVIMTPVDALATLTLNESSHYGRTSYPYLYRKIIRKHGYKGF 246
            |                |....|.|:.|.:.|.|   |..::.|  ..:.....|..|..|.:.|
  Fly   240 W----------------LACYPIDVVKTHMQADA---LGANAKY--NGFIDCAMKGFRNEGPQYF 283

  Fly   247 FFGWKPALMALIPHTVLATFVYRFLLD 273
            |.|....|:...|......||..::||
  Fly   284 FRGLNSTLIRAFPMNAACFFVVSWVLD 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 19/78 (24%)
Mito_carr 187..277 CDD:278578 20/87 (23%)
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 19/77 (25%)
PTZ00169 41..295 CDD:240302 53/270 (20%)
Mito_carr 128..218 CDD:278578 12/89 (13%)
Mito_carr 221..304 CDD:278578 22/105 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441394
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.