DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and MME1

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster


Alignment Length:300 Identity:55/300 - (18%)
Similarity:100/300 - (33%) Gaps:89/300 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLSHPMELVRVNMQA-------------NVIHHSRLSINHMFRLMARHGLPGFYYGIVAACLRCT 66
            |:.||::.::|.:|.             .||..:.       |.....|..|||.||.|..:..|
  Fly    30 LVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAA-------RTFRYEGFRGFYRGISAPLVGVT 87

  Fly    67 -VHTM--STYTLFYNL-QDNKYVLMLQPYNTSMVLGITGFWGGVLATPFAKLAVIRQAD------ 121
             ::.:  :.|.....| |.:.::.:..| .......:.|....::..|..::.|:.|..      
  Fly    88 PIYAVDFAVYAAGKRLFQTDDHIRLTYP-QIFAAGALAGVCSALVTVPTDRIKVLLQTQTVSNGP 151

  Fly   122 -LTRGSYERRNYRNFWRGLKCMYAKGGFTYLFTGWKINSISSTAVAVL-----------YTPISD 174
             |..|:.:.         ...:|.:||...||.|        |...:|           |..:.:
  Fly   152 LLYNGTIDT---------AAKLYRQGGIRSLFKG--------TCACILRDSPTGFYFVTYEFLQE 199

  Fly   175 ---------KVHTVISWFHRLDEPWLSDLITMALTGSIITVIMTPVDALATLTLNESSHYGRTSY 230
                     |:.|.            |.:::....|.:...:..|.|.|.:..  :|:..|  :|
  Fly   200 LARKKSANGKISTT------------STILSGGTAGIVFWTLAVPFDVLKSRL--QSAPEG--TY 248

  Fly   231 PY----LYRKIIRKHGYKGFFFGWKPALMALIPHTVLATF 266
            .:    ::|.::...|.|..|.|..|.|:...|.|....|
  Fly   249 KHGIRSVFRNLMATEGPKALFRGILPILLRAFPSTAAVFF 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 18/82 (22%)
Mito_carr 187..277 CDD:278578 17/83 (20%)
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 19/83 (23%)
Mito_carr 111..205 CDD:278578 16/111 (14%)
Mito_carr 208..297 CDD:278578 19/96 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441731
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.