DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and colt

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster


Alignment Length:285 Identity:54/285 - (18%)
Similarity:102/285 - (35%) Gaps:58/285 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLSHPMELVRVNMQA--------NVIHHSRLSINHMFRLMARHGLPGFYYG----------IVAA 61
            |..||::.::|.:|.        ..::  |.:.:...:.:...|:.|.|.|          |.|.
  Fly    31 LSGHPLDTIKVRLQTMPRPAPGEQPLY--RGTFDCAAKTIKNEGVRGLYKGMSAPLTGVAPIFAM 93

  Fly    62 CLRCTVHTMSTYTLFYNLQ----DNKYVLMLQPYNTSMVLG-ITGFWGGVLATPFAKLAVIRQAD 121
            |       .:.|.|...||    |.|..     |....|.| .:|.:..::..|..::.|:.|..
  Fly    94 C-------FAGYALGKRLQQRGEDAKLT-----YPQIFVAGSFSGLFSTLIMAPGERIKVLLQTQ 146

  Fly   122 LTRGSYERRNYRNFWRGLKC---MYAKGGFTYLFTGWKINSISSTAVAVLYTPISDKVHTVISWF 183
            ..:|.  .|.|...   :.|   :|.:||...:|.|.....:.......||..:.:.:..|..  
  Fly   147 QGQGG--ERKYNGM---IDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEALQDVAK-- 204

  Fly   184 HRLDEPWLSDLITM---ALTGSIITVIMTPVDALATLTLNESSHYGRTSYPY----LYRKIIRKH 241
            .:.:...:|...|:   .:.|....::..|.|.|.:..  :|:..|  :|.:    :::.:|.|.
  Fly   205 SKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRL--QSAPEG--TYKHGIRSVFKDLIVKD 265

  Fly   242 GYKGFFFGWKPALMALIPHTVLATF 266
            |....:.|..|.::...|......|
  Fly   266 GPLALYRGVTPIMLRAFPANAACFF 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 17/87 (20%)
Mito_carr 187..277 CDD:278578 16/87 (18%)
coltNP_477221.1 Mito_carr 12..107 CDD:395101 17/84 (20%)
Mito_carr 112..202 CDD:395101 19/99 (19%)
Mito_carr 210..299 CDD:395101 16/85 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441725
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.