DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and Ant2

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster


Alignment Length:172 Identity:29/172 - (16%)
Similarity:62/172 - (36%) Gaps:26/172 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TAQLLSHPMELVRVNMQANVIHHSRLSINH----MFRLMARHGLPGFYYGIVAACLRCTVHTMST 72
            |:....:|::..|..:.|:|........|.    :.:::...|..|.|.|.:.:.....::..:.
  Fly   136 TSLCFVYPLDFARTRLAADVGKGGNREFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRAAY 200

  Fly    73 YTLFYNLQDNKYVLMLQPYNTSMVLGITGFW---------GGVLATPF--AKLAVIRQADLTRGS 126
            :..:...:|    .:..|.:|...:.    |         .|:.:.||  .:..::.|:.|.:..
  Fly   201 FGFYDTCRD----FLPNPKSTPFYVS----WAIAQVVTTVAGIASYPFDTVRRRMMMQSGLKKSE 257

  Fly   127 YERRNYRNFWRGLKCMYAKGGFTYLFTGWKINSISSTAVAVL 168
            ...:|..:.|..:......|.|   |.|...|.|..|..|::
  Fly   258 MVYKNTAHCWLVIAKQEGIGAF---FKGALSNIIRGTGGALV 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 10/72 (14%)
Mito_carr 187..277 CDD:278578
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 29/172 (17%)
Mito_carr 17..111 CDD:278578
Mito_carr 119..215 CDD:278578 11/82 (13%)
Mito_carr 218..307 CDD:278578 16/86 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441946
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.