DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and CG1628

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster


Alignment Length:313 Identity:60/313 - (19%)
Similarity:99/313 - (31%) Gaps:106/313 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LSHPMELVRVNMQANVIHHSRLSINHMFRLM--------ARHG-LPGFYYGIVAACLRCTVHTMS 71
            :|.|::.|:|.:|         :....:|.|        .:.| |.|.|.|.|.|          
  Fly   186 VSQPLDTVKVKLQ---------TFPEAYRGMLDCFLSTYRKDGVLRGLYAGSVPA---------- 231

  Fly    72 TYTLFYNLQDN-----------KYVLMLQPYNTSMVL-GITGFWGGVLATPFA------------ 112
               :|.|:.:|           |:|.......|:..| .:.....|.||..|:            
  Fly   232 ---VFANVAENSVLFAAYGGCQKFVAFCVGKETAGDLTTVQNACAGSLAACFSTLTLCPTELIKC 293

  Fly   113 KLAVIRQA----------------DLTRGSYERRNYRNFWRGLKCMYAK--GGFTYLFTGW---- 155
            ||..:|:.                .|||..:.....|.|:|||...:.:  .|:.:.|..:    
  Fly   294 KLQALREMKNFVEPAHPQDIRTPWTLTRYIWRTEGIRGFYRGLSSTFLREMPGYFFFFGSYEGTR 358

  Fly   156 ---KINSISSTAVAVLYTPISDKVHTVISWFHRLDEPWLSDLITMALTGSIITVIMTPVDALATL 217
               :.:..|...:..|.|.|:..:..|..|             |......:|.      ..:...
  Fly   359 ELLRRDDQSKDDIGPLRTMIAGAIGGVCLW-------------TSTFPADVIK------SRIQVK 404

  Fly   218 TLNESSHYGRTSYPYLYRKIIRKHGYKGFFFGWKPALMALIPHTVLATFVYRF 270
            .||||..       .:...|:|:.|....:.|..|:::..||.|.....||.:
  Fly   405 NLNESMF-------AVGADIVRREGVLALYRGLLPSVLRTIPATATLFVVYEY 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 16/73 (22%)
Mito_carr 187..277 CDD:278578 16/84 (19%)
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 60/313 (19%)
Mito_carr 170..252 CDD:278578 17/87 (20%)
Mito_carr 263..364 CDD:278578 18/100 (18%)
Mito_carr 369..455 CDD:278578 21/108 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441850
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.