DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and CG5254

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster


Alignment Length:291 Identity:56/291 - (19%)
Similarity:102/291 - (35%) Gaps:47/291 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LSHPMELVRVNMQANV-----------IHHSRLSINHMFRLMARH-GLPGFYYGIVAACLRCTVH 68
            :..|:::|:..:|...           :|::  .:...|..|.|| |:..::.||:...|..|..
  Fly    31 IMQPLDVVKTRIQIQATPAPNAAALGEVHYN--GVFDCFAKMYRHEGISSYWKGIMPPILAETPK 93

  Fly    69 TMSTYTLFYNLQDNKYVLML-QPYNTSMVLGITGFWGGVL----ATPFAKLAVIRQADLTRGSYE 128
            ....:.:|   :..|.:... .|..|.:...:.|...|.|    ..||..:.|.:|||     .:
  Fly    94 RAIKFLVF---EQTKPLFQFGSPTPTPLTFSLAGLTAGTLEAIAVNPFEVVKVAQQAD-----RQ 150

  Fly   129 RRNYRNFWRGLKCMYAKG-------GFTYLFTGWKINSISSTAVAVLYTPISDKVHTVISWFHRL 186
            ::....|      ..|||       ||:.|..|.......:....::|......|..|:..:...
  Fly   151 KKMLSTF------AVAKGIIQQDGLGFSGLNKGITATMGRNGVFNMVYFGFYHSVKNVVPEYKES 209

  Fly   187 DEPWLSDLITMALTGSIITVIMTPVDALATLTLNESSHYGRTSYPYLYRK---IIRKHGYKGFFF 248
            ...:|..:....|.|::...:..|.|...:.........|:..|......   :.|:.|::..:.
  Fly   210 HLEFLRKVTIGFLAGTLACFVNIPFDVAKSRIQGPQPVPGQIKYRGTLSSMGIVYREEGFRALYK 274

  Fly   249 GWKPALMALIPHTVLATFV----YRFLLDRY 275
            |..|.:|.|.|...:...|    |.:||..|
  Fly   275 GLVPKIMRLGPGGAILLLVFEYSYDYLLHNY 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 14/76 (18%)
Mito_carr 187..277 CDD:278578 19/96 (20%)
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 15/85 (18%)
PTZ00169 19..301 CDD:240302 53/285 (19%)
Mito_carr 122..207 CDD:278578 20/95 (21%)
Mito_carr 209..305 CDD:278578 18/95 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441957
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.