DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and Slc25a10

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_038798.2 Gene:Slc25a10 / 27376 MGIID:1353497 Length:287 Species:Mus musculus


Alignment Length:276 Identity:72/276 - (26%)
Similarity:124/276 - (44%) Gaps:24/276 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YVGLLIKTTAQLLSHPMELVRVNMQANVIHHSRLSINHM-FRLMARHGLPGFYYGIVAACLRCTV 67
            |.|.|....|...:||::|::|::|..  ...:|.:..| .:::...|....|.|:.|:..|...
Mouse    10 YFGGLASCGAACCTHPLDLLKVHLQTQ--QEVKLRMTGMALQVVRTDGFLALYNGLSASLCRQMT 72

  Fly    68 HTMSTYTLFYNLQDNKYVLM-----LQPYNTSMVLGITGFWGGVLATPFAKLAVIRQADLTRGSY 127
            ::::.:.::..::|  |:..     |..||..::.||:|..||.:.||...:.|..|.|:.....
Mouse    73 YSLTRFAIYETMRD--YMTKDSQGPLPFYNKVLLGGISGLTGGFVGTPADLVNVRMQNDMKLPPS 135

  Fly   128 ERRNYRNFWRGLKCMYAKGGFTYLFTGWKINSISSTAVAVLYTPISDKVHTVISWFHRLDEPWLS 192
            :||||.:...||..:..:.....||:|..:.|.....|.|......|:...::     |...:||
Mouse   136 QRRNYSHALDGLYRVAREESLRKLFSGATMASSRGALVTVGQLSCYDQAKQLV-----LSTGYLS 195

  Fly   193 D-----LITMALTGSIITVIMTPVDALATLTLNESSHYGRTSYPYLYRKIIRKHGYKGFFFGWKP 252
            |     .::..:.|...|.:..|:|.|.|..:|....|....:..:.   ..|.|.:.||.|..|
Mouse   196 DNIFTHFVSSFIAGGCATFLCQPLDVLKTRLMNSKGEYQGVFHCAME---TAKLGPQAFFKGLFP 257

  Fly   253 ALMALIPHTVLATFVY 268
            |.:.||||||| ||::
Mouse   258 AGIRLIPHTVL-TFMF 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 15/75 (20%)
Mito_carr 187..277 CDD:278578 27/87 (31%)
Slc25a10NP_038798.2 Solcar 1 7..87 17/80 (21%)
Mito_carr 12..92 CDD:278578 17/83 (20%)
Mito_carr 94..189 CDD:278578 26/99 (26%)
Solcar 2 100..187 24/86 (28%)
Solcar 3 196..279 25/81 (31%)
Mito_carr 197..283 CDD:278578 24/80 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849319
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.800

Return to query results.
Submit another query.