DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and SLC25A30

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_005266378.1 Gene:SLC25A30 / 253512 HGNCID:27371 Length:293 Species:Homo sapiens


Alignment Length:306 Identity:63/306 - (20%)
Similarity:112/306 - (36%) Gaps:96/306 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PVYVGLLIKTTAQLLSHPMELVRVNM----QANVIHHSRLSINHMFRLMAR----HGLPGFYYGI 58
            |...|.|...||:..:.|::|.:..:    |.|......:....|...:.|    .||...|.||
Human     8 PFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIGREEGLKALYSGI 72

  Fly    59 VAACLRCTVH---TMSTYTLFYNLQDNKYVLMLQPYNTSMVLG-ITGFWGGVLATPFA------K 113
            ..|.||...:   .:.||      |..|.:.:.:|.:.::.:. |.|...||:::..|      |
Human    73 APAMLRQASYGTIKIGTY------QSLKRLFIERPEDETLPINVICGILSGVISSTIANPTDVLK 131

  Fly   114 LAVIRQADLTRGS--------YERRNYRNFWRGLKCMYAKGGFTYLFTGWKINSISSTAVAVLY- 169
            :.:..|::..:|.        |::...|..|:|:                   |:::...|::. 
Human   132 IRMQAQSNTIQGGMIGNFMNIYQQEGTRGLWKGV-------------------SLTAQRAAIVVG 177

  Fly   170 --TPISD--KVHTVIS-------WFHRLDEPWLSDLITMALTGSIITVIMTPVDALATLTLNESS 223
              .|:.|  |.|.::|       :.|.|..      .|..|.|::.:   .|||.:.|..:|:  
Human   178 VELPVYDITKKHLILSGLMGDTVYTHFLSS------FTCGLAGALAS---NPVDVVRTRMMNQ-- 231

  Fly   224 HYGRTSYPYLYRKIIRK---HGYKGFFFGWKPALMALIPHTVLATF 266
                        :::|.   .||.|       .|..|:..|||.:|
Human   232 ------------RVLRDGRCSGYTG-------TLDCLLQLTVLESF 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 20/85 (24%)
Mito_carr 187..277 CDD:278578 18/83 (22%)
SLC25A30XP_005266378.1 Mito_carr 5..100 CDD:278578 23/97 (24%)
Mito_carr 102..191 CDD:278578 18/107 (17%)
Mito_carr 199..>252 CDD:278578 16/82 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.