DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and Ucp1

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_036814.1 Gene:Ucp1 / 24860 RGDID:3931 Length:307 Species:Rattus norvegicus


Alignment Length:287 Identity:62/287 - (21%)
Similarity:101/287 - (35%) Gaps:77/287 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AQLLSHPMELVRVNMQ-------ANVIHHSRLSINHMFRLMARHGLPGFYYGIVAACLRCTVHTM 70
            |.:::.|::..:|.:|       ::.|.:..: :..:..|....|||..|.|:.|...|    .:
  Rat    27 ADIITFPLDTAKVRLQIQGEGQASSTIRYKGV-LGTITTLAKTEGLPKLYSGLPAGIQR----QI 86

  Fly    71 STYTLFYNLQDNKYVLMLQPYNTS----------------MVLGITGFWGGVLATPFAKLAVIRQ 119
            |..:|...|.|.     :|.|.:|                |..|:..|.|  ..|...|:.:..|
  Rat    87 SFASLRIGLYDT-----VQEYFSSGRETPASLGSKISAGLMTGGVAVFIG--QPTEVVKVRMQAQ 144

  Fly   120 ADLTRGSYERRNYRNFWRGLKCMYAKGGFTY-----------LFTGWK-------INSISSTAVA 166
            :.|              .|:|..|..   ||           |.|.||       .|.|.:....
  Rat   145 SHL--------------HGIKPRYTG---TYNAYRVIATTESLSTLWKGTTPNLMRNVIINCTEL 192

  Fly   167 VLYTPISDKVHTVISWFHRLDEPWLSDLITMALTGSIITVIMTPVDALATLTLNE-SSHYGRTSY 230
            |.|    |.:...:...|.|.:.....|::..:.|...|::.:|||.:.|..:|. ...|  .|.
  Rat   193 VTY----DLMKGALVNHHILADDVPCHLLSALVAGFCTTLLASPVDVVKTRFINSLPGQY--PSV 251

  Fly   231 PYLYRKIIRKHGYKGFFFGWKPALMAL 257
            |.....:..|.|...||.|:.|:.:.|
  Rat   252 PSCAMTMYTKEGPAAFFKGFAPSFLRL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 16/74 (22%)
Mito_carr 187..277 CDD:278578 18/72 (25%)
Ucp1NP_036814.1 Mito_carr 10..103 CDD:278578 18/85 (21%)
Solcar 1 11..102 18/84 (21%)
PTZ00169 21..297 CDD:240302 62/287 (22%)
Mito_carr 110..205 CDD:278578 22/117 (19%)
Solcar 2 111..201 22/112 (20%)
Solcar 3 210..295 18/71 (25%)
Mito_carr 215..300 CDD:278578 18/66 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.