DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and Ucp3

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_033490.1 Gene:Ucp3 / 22229 MGIID:1099787 Length:308 Species:Mus musculus


Alignment Length:281 Identity:64/281 - (22%)
Similarity:113/281 - (40%) Gaps:36/281 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AQLLSHPMELVRVNMQANVIHHSRLSINH------MFRLMARHGLPGFYYGIVAACLRCTVHTMS 71
            |.||:.|::..:|.:|....:....|:.:      :..::...|....|.|:||...|    .||
Mouse    27 ADLLTFPLDTAKVRLQIQGENPGAQSVQYRGVLGTILTMVRTEGPRSPYSGLVAGLHR----QMS 87

  Fly    72 TYTLFYNLQDNKYVLMLQPY------NTSMVLGI-----TGFWGGVLATPFAKLAVIRQADLTRG 125
                |.:::...|..:.|.|      ::|:.:.|     ||......|.|...:.|..||.:..|
Mouse    88 ----FASIRIGLYDSVKQFYTPKGADHSSVAIRILAGCTTGAMAVTCAQPTDVVKVRFQAMIRLG 148

  Fly   126 SYERRNYRNFWRGLKCMYAKGGFTYLFTG-W---KINSISSTAVAVLYTPISDKVHTVISWFHRL 186
            :...|.||......:.:..:.|...|:.| |   ..|:|.:.|..|.|..|.:|    :...|..
Mouse   149 TGGERKYRGTMDAYRTIAREEGVRGLWKGTWPNITRNAIVNCAEMVTYDIIKEK----LLESHLF 209

  Fly   187 DEPWLSDLITMALTGSIITVIMTPVDALATLTLNESSHYGRTSYP-YLYRKIIRKHGYKGFFFGW 250
            .:.:....::....|...||:.:|||.:.|..:|  :..||...| :...|::.:.|...|:.|:
Mouse   210 TDNFPCHFVSAFGAGFCATVVASPVDVVKTRYMN--APLGRYRSPLHCMLKMVAQEGPTAFYKGF 272

  Fly   251 KPALMALIPHTVLATFVYRFL 271
            .|:.:.|....|:....|..|
Mouse   273 VPSFLRLGAWNVMMFVTYEQL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 16/73 (22%)
Mito_carr 187..277 CDD:278578 20/86 (23%)
Ucp3NP_033490.1 Mito_carr 10..107 CDD:278578 19/87 (22%)
Solcar 1 11..102 17/82 (21%)
PTZ00169 13..298 CDD:240302 64/281 (23%)
Mito_carr 109..206 CDD:278578 24/100 (24%)
Solcar 2 111..202 23/90 (26%)
Mito_carr 209..299 CDD:278578 20/87 (23%)
Solcar 3 211..296 20/85 (24%)
Purine nucleotide binding. /evidence=ECO:0000250 275..297 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.