DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16736 and slc-25A10

DIOPT Version :9

Sequence 1:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_509133.1 Gene:slc-25A10 / 180940 WormBaseID:WBGene00019656 Length:290 Species:Caenorhabditis elegans


Alignment Length:285 Identity:72/285 - (25%)
Similarity:132/285 - (46%) Gaps:43/285 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YVGLLIKTTAQLLSHPMELVRVNMQANVIHHSRLSINHM-FRLMARHGLPGFYYGIVAACLRCTV 67
            |.|.:....|...:||::|::|.:|..  ...:|:|..: .::....|:..||.|:.|:.||...
 Worm    13 YFGGVAGAMAACCTHPLDLLKVQLQTQ--QQGKLTIGQLSLKIYKNDGILAFYNGVSASVLRQLT 75

  Fly    68 HTMSTYTLFYNLQDNKYVLMLQP---YNTSMVLGITGFWGGVLATPFAKLAVIRQADLTRGSYER 129
            ::.:.:.::..::  |.:...||   |..:::.|..|..||::.||...:.|..|.|......:|
 Worm    76 YSTTRFGIYETVK--KQLPQDQPLPFYQKALLAGFAGACGGMVGTPGDLVNVRMQNDSKLPLEQR 138

  Fly   130 RNYRNFWRGLKCMYAKGGFTYLFTGWKINSISSTAVAVLYTPISDKVHTVISWFHRLDEPWLSD- 193
            |||::...||..:..:.||..:|.|    :..:|:.|:|.| |..     :|::.::.:..:|. 
 Worm   139 RNYKHALDGLVRITREEGFMKMFNG----ATMATSRAILMT-IGQ-----LSFYDQIKQTLISSG 193

  Fly   194 ---------LITMALTGSIITVIMTPVDALATLTLNESSHYGRTSYPYLYRKII------RKHGY 243
                     ..:.....|:.||:..|:|.:.|..:|.:        |..::.|:      .|.|.
 Worm   194 VAEDNLQTHFASSISAASVATVMTQPLDVMKTRMMNAA--------PGEFKGILDCFMFTAKLGP 250

  Fly   244 KGFFFGWKPALMALIPHTVLATFVY 268
            .|||.|:.||...|.||||| ||::
 Worm   251 MGFFKGFIPAWARLAPHTVL-TFIF 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 16/75 (21%)
Mito_carr 187..277 CDD:278578 26/98 (27%)
slc-25A10NP_509133.1 PTZ00169 3..279 CDD:240302 72/285 (25%)
Mito_carr 15..91 CDD:278578 17/79 (22%)
Mito_carr 95..193 CDD:278578 29/107 (27%)
Mito_carr 214..283 CDD:278578 24/70 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166465
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.